SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|512443654|ref|YP_008118933.1| from Treponema pallidum subsp. pallidum SS14

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|512443654|ref|YP_008118933.1|
Domain Number 1 Region: 24-253
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.91e-51
Family Extended AAA-ATPase domain 0.000000469
Further Details:      
 
Domain Number 2 Region: 260-334
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-23
Family Helicase DNA-binding domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|512443654|ref|YP_008118933.1|
Sequence length 350
Comment crossover junction endoribonuclease subunit B [Treponema pallidum subsp. pallidum SS14]
Sequence
MDHTASLSPVRPEAQPTDDRERALRPRLLKDFLGQEKTKRNLRLFIQAARDRNESLDHLF
LIGPPGLGKTTLAHITACELGVECKVTGAPALDKPKDLAGILTALSERSVFFVDEIHRLK
PAIEEMLYIAMEDYELDWVIGQGPSARTVRIPLPPFTLIGATTRAGMVSSPLISRFGIVE
RFEFYTPEELAAIVQRSARLLDITLDARAALALARCSRGTPRVANRLLRRIRDFAQVAGS
AHISETIVRAGLAHLKIDELGLELHDIQLLRVMIEHFGGGPVGAETLAISLGESPETLED
YYEPYLIQIGLMQRTPRGRMATARAYAHLGLPVPEARTLTPHSPEQGTLL
Download sequence
Identical sequences A0A0A7X3W6 A0A0H3BJX6 F7XRZ9 H6KT00 P96115 R9UV60
gi|378981647|ref|YP_005229952.1| gi|378973738|ref|YP_005222344.1| gi|488657586|ref|YP_007935968.1| gi|408502063|ref|YP_006869507.1| 243276.TP0162 455434.TPASS_0162 gi|189025395|ref|YP_001933167.1| gi|512443654|ref|YP_008118933.1| gi|378974800|ref|YP_005223408.1| WP_010881609.1.101681 WP_010881609.1.10609 WP_010881609.1.11013 WP_010881609.1.177 WP_010881609.1.22706 WP_010881609.1.24110 WP_010881609.1.24144 WP_010881609.1.26337 WP_010881609.1.26670 WP_010881609.1.28216 WP_010881609.1.31174 WP_010881609.1.34567 WP_010881609.1.35526 WP_010881609.1.35589 WP_010881609.1.37724 WP_010881609.1.38137 WP_010881609.1.38252 WP_010881609.1.38852 WP_010881609.1.39803 WP_010881609.1.41302 WP_010881609.1.4135 WP_010881609.1.42739 WP_010881609.1.42752 WP_010881609.1.43796 WP_010881609.1.44774 WP_010881609.1.45335 WP_010881609.1.49513 WP_010881609.1.50901 WP_010881609.1.51333 WP_010881609.1.6132 WP_010881609.1.61389 WP_010881609.1.63356 WP_010881609.1.72815 WP_010881609.1.73546 WP_010881609.1.74079 WP_010881609.1.78381 WP_010881609.1.79283 WP_010881609.1.82112 WP_010881609.1.89996 WP_010881609.1.90600 WP_010881609.1.90779 WP_010881609.1.92130 WP_010881609.1.96085 WP_010881609.1.98226 WP_010881609.1.98956 WP_010881609.1.99137 WP_010881609.1.99367 gi|378972671|ref|YP_005221275.1| gi|338706139|ref|YP_004672907.1| gi|15639155|ref|NP_218601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]