SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187250559|ref|YP_001875041.1| from Elusimicrobium minutum Pei191

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187250559|ref|YP_001875041.1|
Domain Number 1 Region: 198-387
Classification Level Classification E-value
Superfamily PheT/TilS domain 4.97e-63
Family B3/B4 domain of PheRS, PheT 0.0000159
Further Details:      
 
Domain Number 2 Region: 38-194
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-34
Family Myf domain 0.0034
Further Details:      
 
Domain Number 3 Region: 461-682
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00048
Further Details:      
 
Domain Number 4 Region: 696-790
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.32e-22
Family Anticodon-binding domain of PheRS 0.00083
Further Details:      
 
Domain Number 5 Region: 399-469
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000531
Family Domains B1 and B5 of PheRS-beta, PheT 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|187250559|ref|YP_001875041.1|
Sequence length 791
Comment phenylalanyl-tRNA synthetase subunit beta [Elusimicrobium minutum Pei191]
Sequence
MKILYSWLKDYIDIDLSAEELAQKLNSVGIEVAEIQKTGVDFEGVHTAKIVTLERHPNAD
KLSLVTLDTGNGTRKVVCGAGNLEAGIIVPLAREGARLGKTVLKAAEIRGVKSDGMICSS
DELGLTATRQKGILHLDKNLKPGIDVSTLYPKADYLFELEITSNRPDLLSHLGVARELSI
LLNIPLKEIPLKEVKEEGESIDVKIETENCARYTSRVVRGVQNAQSPEWMKQRLSAMGVN
PKNALVDISNYVLYDIGLPLHFFDLSDIGESVIIRQAAEGEVFETLDGSKLNLTAQDILI
ADKNKGLCLAGIMGGIGSGIKETTKNIFIEAAYFNPPAINKSAKKYGFSSEASQRFERGA
DIGITPKALARATNLVQELCGGKASKSSDVYPVPYTPEEVSFTPEDIEKILGMKIDEERF
KEIFSRLAQKFDASLKPWKFNSPTHRRDLNHKWDLAEEAARFYGLDKLPVSETRASVAFS
DNPRNTDTSAKFASALISAGFYECKNFDFLCENDLQNFSYKKEFCVEIANPLNEDYQYMR
PTLFAGLLKNANFNQSRGTTEYKIFETGKEYQIMKGFPAETWVMAGIVCGAVREQYFADK
TPEADFYFVKGAVEAALKNIAGVNFSASKEAPAYMHPKICADIIVDGKQKAGFIGKIHPL
TAKAYGLKNDDIYAFYLNIKVLEKKFNAQEFKPAEDAAQFPSSYRDLSFVIGKDVGYAKV
LQAVNSSGVWSKMSVDLMDVYTGANLPEGKKSLTLNFAFWLMDRTLKDAEVEENMNKIFT
ALTALGAELRK
Download sequence
Identical sequences B2KBL7
gi|187250559|ref|YP_001875041.1| 445932.Emin_0138 WP_012414319.1.71589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]