SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|187251807|ref|YP_001876289.1| from Elusimicrobium minutum Pei191

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|187251807|ref|YP_001876289.1|
Domain Number 1 Region: 85-179
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.7e-28
Family Ribosomal protein L6 0.00016
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.83e-17
Family Ribosomal protein L6 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|187251807|ref|YP_001876289.1|
Sequence length 184
Comment 50S ribosomal protein L6 [Elusimicrobium minutum Pei191]
Sequence
MSRIGKKPIQIPGKVKVDIKGAELTATGPLGSLNYTLPSGLKAVIDNGILNISIEEKGKE
KLLNAIHGTTRANVFNVIEGVDKGFSKVLEINGLGYKAIVAGTKLTIEVGLSHPVIFDIP
KGLTAAYDGKTNTLEIKGSDKFLVGDFAAKIRRVRPPEPYKGSGIKYQGEHIARKAGKTA
AGGK
Download sequence
Identical sequences B2KEK6
gi|187251807|ref|YP_001876289.1| 445932.Emin_1403 WP_012415567.1.71589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]