SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000000102 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000000102
Domain Number 1 Region: 232-474
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.34e-58
Family Decarboxylase 0.000000468
Further Details:      
 
Domain Number 2 Region: 5-195
Classification Level Classification E-value
Superfamily PRTase-like 7.87e-45
Family Phosphoribosyltransferases (PRTases) 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000000102   Gene: ENSAMXG00000000103   Transcript: ENSAMXT00000000102
Sequence length 478
Comment pep:known_by_projection scaffold:AstMex102:KB871858.1:146038:153525:-1 gene:ENSAMXG00000000103 transcript:ENSAMXT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGVRALVLELFDVRAVKFGQFKLKSGLTSPVYFDLRVIVSYPQLLNQVSSLLYQCAAD
AGVRYDCVCGVPYTALPLATIICSTKNYPMLIRRKEAKDYGTKRLIEGNIRPGDKCLIVE
DVVTSGSSVLETAQVLQAEGLKVTDAVVLLDREQGGGAKLADEGVTLHPVISISTLLSVL
LSAGRIDQEMCSSVERFVRENQTFRAGQENGSVVKRKCEELSYSARAALPGAHPLAARLL
RLMEQKRSNLCVSADVTAAAELLELAELLGPLMCVLKTHVDVLQDFTPELRDRLQEIAHK
HDFLLFEDRKFADIGNTVKHQYQGGVYQISSWAHIVNAHAVPGPGVVEGLRAVGQSLGRG
CLLIAQMSSQGSLATAEYTQAVVKMAESFPDFVFGFISGSKISSNPELIHMTPGVQMQSG
GDGLGQQYTTPDEVIGSKGSDIIIVGRGIIASEDRLKAAEEYRKAGWEAHLNRLSASS
Download sequence
Identical sequences W5JXP2
XP_007235657.1.101067 XP_015457481.1.101067 ENSAMXP00000000102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]