SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001953 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001953
Domain Number 1 Region: 8-219
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.95e-43
Family D-ribulose-5-phosphate 3-epimerase 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001953   Gene: ENSAMXG00000001907   Transcript: ENSAMXT00000001953
Sequence length 231
Comment pep:known_by_projection scaffold:AstMex102:KB871578.1:1371640:1374076:1 gene:ENSAMXG00000001907 transcript:ENSAMXT00000001953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVNMAYSAKIGPSILSSDLSQLGAECRRMMECGADYLHLDVMDGHIVMKICLEEPHMLSL
LSTDQIISFFCSDVYILKYSSGKKNKRALKNDEFLLFYQIKNNFWNIIKRVLNGCVQVGL
AIKPNTTVEELAPWAGQIDMALVMTVEPGFGGQKFMEDMMPKVSWLRSQFPSLDIEVDGG
VGPDTIHRCAEAGANMIVSGSAVVSSDDPRAVIALLKDVVLEAIQKRFLDR
Download sequence
Identical sequences W5K2Z2
ENSAMXP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]