SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000009047 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000009047
Domain Number 1 Region: 28-96
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000277
Family Ovomucoid domain III-like 0.0064
Further Details:      
 
Domain Number 2 Region: 139-219
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000116
Family Calmodulin-like 0.076
Further Details:      
 
Domain Number 3 Region: 225-269
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000068
Family VWC domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000009047   Gene: ENSAMXG00000008803   Transcript: ENSAMXT00000009047
Sequence length 309
Comment pep:known_by_projection scaffold:AstMex102:KB871750.1:233784:310423:1 gene:ENSAMXG00000008803 transcript:ENSAMXT00000009047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRGLLLAALAVVYCQAEESQSKSKVCANVFCGAGRECSVTEKGEPSCLCIEQCKPHKR
SVCGSNGKTYRNHCELHRDACLTGLKIQVAHDGHCRERKTEKAAASPVVCYVADRNELRR
RVIEWLQTEVVPDGWFTKGSNFTDILLKYFKNYDNGDSQMDSTELLHFIQHNESAVELSS
YAEEENNRLLRSLCVDALIELSDQNSDWKLSFDEFLNCLRPGFNPPEKKCALEDETYEDG
AETQVECNRCVCACGNWVCTAMTCDEKSPAPEAATGDEEMTEEEWSRRVAELNKHQETVE
KMKSSTKEV
Download sequence
Identical sequences W5KN85
XP_007233130.1.101067 ENSAMXP00000009047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]