SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000010671 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000010671
Domain Number 1 Region: 38-216
Classification Level Classification E-value
Superfamily EF-hand 1.21e-51
Family Penta-EF-hand proteins 0.000000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000010671   Gene: ENSAMXG00000010385   Transcript: ENSAMXT00000010671
Sequence length 218
Comment pep:known_by_projection scaffold:AstMex102:KB871938.1:4048397:4070904:1 gene:ENSAMXG00000010385 transcript:ENSAMXT00000010671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLARQFIGGIIDVVSNVDPAQFGPSEPPPVRRPQVNVQAQSNESDEERQFRKVFLQLAG
DDMEVSANELMNILNKIIGKHKDLKTEGFTLDSCRAMVATMDTDSSGKLGFQEFKYLWNN
IKKWQGVYKAYDADRSGTIGADELPAAFRAAGFPLSDHLFQMIIRRYSDESGNMDFDNFI
GCLVRLDAMCRAFRTLDKNNTGTVKVNIKEWLQLMMYS
Download sequence
Identical sequences W5KSV9
ENSAMXP00000010671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]