SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000011397 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSAMXP00000011397
Domain Number - Region: 51-130
Classification Level Classification E-value
Superfamily BRCA2 helical domain 0.0051
Family BRCA2 helical domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000011397   Gene: ENSAMXG00000011092   Transcript: ENSAMXT00000011397
Sequence length 163
Comment pep:known_by_projection scaffold:AstMex102:KB872494.1:121401:125658:1 gene:ENSAMXG00000011092 transcript:ENSAMXT00000011397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGTYRCNYTRKRFRIIYNNLHGNNRRSGRAPSSGLPLRKNHEPFSIQADKKEKTRHNHF
IKTAQPYKPKLESSSDLQQKRSREEVVDIDDPETRRFPYPFNELLVWAVLMKRQKMSLFF
WQHGEESMAKALVACKLCRSMCYEAKKSDVVDDTSEELKEYSK
Download sequence
Identical sequences W5KUY5
ENSAMXP00000011397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]