SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000014167 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000014167
Domain Number 1 Region: 14-98
Classification Level Classification E-value
Superfamily EF-hand 4.61e-26
Family Osteonectin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000014167   Gene: ENSAMXG00000013777   Transcript: ENSAMXT00000014167
Sequence length 108
Comment pep:known_by_projection scaffold:AstMex102:KB876325.1:1426:4347:1 gene:ENSAMXG00000013777 transcript:ENSAMXT00000014167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHAVTDPAAAGRMPEPDPNHTLEERVVHWYFSQLDKNSSGDIGKKEIKPFKRLLRKKSK
PKKCVKKFVEYCDISNDKALSLLELMGCLGVTKEEGTEKKMNLIHSRL
Download sequence
Identical sequences W5L2V5
ENSAMXP00000014167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]