SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000020100 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000020100
Domain Number 1 Region: 27-161
Classification Level Classification E-value
Superfamily EF-hand 1.72e-36
Family Penta-EF-hand proteins 0.00000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000020100   Gene: ENSAMXG00000019518   Transcript: ENSAMXT00000020100
Sequence length 176
Comment pep:known_by_projection scaffold:AstMex102:KB872281.1:144796:153978:-1 gene:ENSAMXG00000019518 transcript:ENSAMXT00000020100 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYGYGAAPGGQPGGFPGGFPGQQQDPLFGYFSAVAGQDGQISAEELQACLTQANFSGGY
KPFSLETCRLMINMLDRDMSGQMGFNEFKELWAVMNGWKQHFMSIDRDMSGTVDAQEMNQ
AICSMGYRLSPQAMNIIVKRYSTHGKITFDDYVACCVKLRSLTGESGIIKLFFFSL
Download sequence
Identical sequences W5LJT8
ENSAMXP00000020100 XP_007240068.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]