SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000021637 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000021637
Domain Number 1 Region: 323-451
Classification Level Classification E-value
Superfamily Plus3-like 1.2e-45
Family Plus3 0.000000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000021637   Gene: ENSAMXG00000021006   Transcript: ENSAMXT00000021637
Sequence length 580
Comment pep:known_by_projection scaffold:AstMex102:KB882109.1:310124:331534:1 gene:ENSAMXG00000021006 transcript:ENSAMXT00000021637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMVNVKKRKGRVVIDSDSEDSASDDNLDQELLSLAKRKRVDSEEQEEPVSKPAASSDSET
SDSGDEWTVGGTKAKKKVKPGKGAEKKNATKKRLNKAASSGSSDGDSSMESSAPEEGEVS
DSESNSSSSSSDSDSSSEDEVFRDGYGDDLMGDEEDRARLEQMTEKEREQELFNRIEKRE
VLKRRFEIKQKLKTAKKKEKEEKKKKQEEEQEKKKQSQVTDTQVVMSHNKERRSKRDEKL
DKKSQAMEELKAEREKKKNRTAELLAKRQPLKTSEVYSDDEEEEEEDDDKSSVKSDRSSR
SSSFDEEEEKEEAPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGN
CSSKPVYRVAEIVDVVETAKVYQLGTTRTNKGLQLRHGNDTRVFRLEFVSNQEFTENEFM
KWKDAMILAGMQIPTLDEITKKEQSIKEALNYKFNDKDIEDIVKEKDRFRKAPPNYAMKK
TQLLKEKAMAEDNGDGDKVKLLQDQLNELEERAEALDRQRTKSISAISYINQRNRSWNIV
ESEKALVAEGQNSKNQQMDPFTRRQCKPTMVSNVRRAPHC
Download sequence
Identical sequences W5LP72
ENSAMXP00000021637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]