SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000000951 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000000951
Domain Number 1 Region: 104-206
Classification Level Classification E-value
Superfamily TAFH domain-like 1.29e-39
Family TAFH domain-like 0.00000289
Further Details:      
 
Domain Number 2 Region: 487-528
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000000000331
Family MYND zinc finger 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000000951
Domain Number - Region: 421-495
Classification Level Classification E-value
Superfamily CAPPD, an extracellular domain of amyloid beta A4 protein 0.00085
Family CAPPD, an extracellular domain of amyloid beta A4 protein 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000000951   Gene: ENSAMXG00000000928   Transcript: ENSAMXT00000000951
Sequence length 583
Comment pep:known_by_projection scaffold:AstMex102:KB882161.1:2206918:2224355:-1 gene:ENSAMXG00000000928 transcript:ENSAMXT00000000951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGFPQRIAFQYSGEKKVPAMPGSPVDVKTHSRPAVSAMPPLPSVNPSGPRPAAFSSTAL
TNGMNHSPPTLNAVPSPPQRYSNGPSSSSSSSLANQQLPATCGARQLSKLKRFLTTLQQF
GNDISPEIGESVRSLVLALVNSTVTIEEFHSRLQEATNFPLRPFVIPFLKANLPLLQREL
LHCARAAKQTPAQYLSQHEHLLLSTAAPSPADSTELLLEPSDNSKRHSPNRGKENGFHER
PPAPLEPPAKRICTISPAPRHSPAHPLPLPAQIHPTPPPLQHYALDDITTPHLYREPHRI
LELRELKDRPRLPGSNGGYHEEPVDHRLTEREWADEWRHLDHSLNTSCSLLSLYRAGMQH
LNSAHTGINWFTSLRFSSTSLTHCFLIILCHSWCKKSSSSADPQRELSLRAAPGYVPDEI
WRKAEEAVNEVKRQAMDEVQKAVAEAEQKAFEMIAAERAKMEKTLAEAKRKATEDAIQVI
NEQEDSSECCWNCGRKASETCSGCNAARYCGSFCQHKDWERHHLICSPGLQAQPKPSQSG
LNARSLPKAPESPSLEKTSSTSRASTPPTPASASASTPDTNTH
Download sequence
Identical sequences W5K041
ENSAMXP00000000951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]