SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000001961 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000001961
Domain Number 1 Region: 956-1083,1115-1320
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-69
Family p120GAP domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 29-190
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-38
Family Calponin-homology domain, CH-domain 0.0000205
Further Details:      
 
Domain Number 3 Region: 1552-1647
Classification Level Classification E-value
Superfamily RGC domain-like 2.35e-30
Family RGC domain 0.0000109
Further Details:      
 
Domain Number 4 Region: 671-701
Classification Level Classification E-value
Superfamily WW domain 0.000089
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000001961   Gene: ENSAMXG00000001849   Transcript: ENSAMXT00000001961
Sequence length 1647
Comment pep:known_by_projection scaffold:AstMex102:KB872011.1:169421:193932:-1 gene:ENSAMXG00000001849 transcript:ENSAMXT00000001961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFANSSIWTSSKDERLTAEEMDEQRIQNVAYQYLCRLEEAKRWMETCLNEELPAPTELEE
ALRNGVLLAKLGHCFAPNVVPLKKIYDLDQERYKATGLQFRHTDNINHWRNAMAEVGLPT
IFHPETTDIYDKKNMPRTVYCIHALSLYLFRLGLAPQIHDLCGKVKFTEEEINNMKRELD
KYGIQMPAFGKIGGILANELSVDEAAVHAAVIAINEAVERGCVEDTAQALRNPNAMLVNL
QEPLMAIYQEMLRQARAHKAAQASVKVNGSMEKDIYEEYLTQSEIQDCITKVNVRAAVEC
VDEAIECGDSLALLSALQSPSLALRGLLRDHADWYLEQLASDREQKALDLGCVDPLDRDE
LQEGVSVANEDAQRSQTMLQAVSKINEALRCGEARQTVRALMNPDAHLPDVYPFAAELYQ
KELAPLQQQCPQGELQQEELFVAVEMLSAVALVNQALEAKDTGAFCATLVSPSAGLSDLD
DGLMQRYFEELVELKRKEGRALLTWNELQSGLNSVNVAAQEEHDQILTIELINQALCRNE
PQKTLAALLLPSSGLKDVLPQNCKRYHDVLTRIKKRKAELSRDPAAELWLADIQEGVRLA
NQDTQRALKMSLGLAAVNQAVKEGKASQTLRVLRLPEVALRSVVSECAEGYQTELGALLR
AKALEGDNRSPWLKTKTPDGSSYYFHLQKLEGTWDRPQGFVQNSIFLNYEEVQAVCSGVT
VAHSREVQWKACEPLVLQLQARARGFLLRQKLSERLHFLNTHLPAIVTIQSHWRRVLQQR
AYRERLQYLYQNWRAVVKIQATVKMWQARRAYLARLRYFRRHVGAIIKIQAFFRASKARE
EYRMLVHSSTPPLSVVRKFAHLLELGDNDIRQEGELLRLREEVVRTIRSNRQLESDLDLM
DLKIGLLVRNRVTLQEVVSHHKKLTKKNKEELSDMMALEKNKGLKSLSKDKREKLETYQH
LFYLLQTQPSYLAQLIFLMPQNKSTSFMETVIFTLFNYGSDCREAYLLLQLFTAALRHEI
KLKVDQPQEVVTGNPTVIKMLISFYRHARGQNALKEILGPAVREVLQDRTLSIRTDPVEI
YKSWINQTESKTGHKSSLPYEVSAEEALSHPEVQQRLNIAITNLKSLTDRVLNAITSNIH
KLPYGLRYTAKVLRDSLHEKFPQANKDEMYKIVGNLVYYRYMNPAVVAPDGFDVVEFGAG
SALLPEQRRILGSIARILQHSAAHKHFHGDSAHLRALNDYITHTHGKFRKFLQAVCDVPE
PEERFNIDEYSEMVILNKPVIYISIGELINTHKLLLEHQDALCPEQNDPLLLLLRDLGKV
PSVQALVGEGVINSGDPNLEQTLAQYNKMEVSLTLTSKFDVFRSSDDKPDARGILLSTKQ
LIIDVIRAQPGDTLSEVLRSSVSQDQEVQHGWMMHRRAQRDARTPEKMKRNQSLIADSNL
SLEEKKRKIQRSLRRLEALGVLTPPDSETQILQLIAKDIRHQRLYRQRRQAELVKLKHAL
HSLHCKSSFQSEQVDYYSQYIATCLRNLTASQVNGKKAADSKGKKSKQPALSYTAARLYE
KGVLLEIEDLPNTQFKNVIFDIIPSEEGGTFLVKARFLGVDMERFPLKYQDLLQLQYEGV
AVMKMFDKAKVNVNLLIFLLNKKFFKK
Download sequence
Identical sequences W5K300
ENSAMXP00000001961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]