SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000002973 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000002973
Domain Number 1 Region: 487-583
Classification Level Classification E-value
Superfamily TAFH domain-like 0.0000000000000017
Family TAFH domain-like 0.0000607
Further Details:      
 
Domain Number 2 Region: 797-834
Classification Level Classification E-value
Superfamily Histone-fold 0.000000000121
Family TBP-associated factors, TAFs 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000002973   Gene: ENSAMXG00000002886   Transcript: ENSAMXT00000002973
Sequence length 1001
Comment pep:known_by_projection scaffold:AstMex102:KB871891.1:396275:421303:1 gene:ENSAMXG00000002886 transcript:ENSAMXT00000002973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGSELLDDVFFSAEVDETAVSAVVGSLESQLIGPGVGKLAGRLQTPGGQRRAAAGDNS
AQTRDNNNTGPGQESARPGQESAGAGVLPVYLLKVQVCLMGLELSILRSSAPPGSGVSDG
TISAPPGESLLASKSAENRILNNFLIIRPNHPKKYNKNMTGATLNGSNMVMVVNSHDSAA
FSNTSSSPAPVPPTPGAAVNNGPGCVLKAPPPPSGTVIQTSLMNTSTVISAQTPGLTTRP
TVALVRPPMQTQVTVAPPNGAAVNAVHLPTTITVAQSHRVDSPKALQTVAQAPTTVVQPI
RGPIMQTGGRTTVPGAVAAGAGAIRAIAPQVLAPRVPPPQQNQPSVHNIQLPPGMVLVRS
ESGQLLMIHQQTLAQMQAQTQGAMAPRPTTPTSTPPVHITSVQAPGTPLITRPVAPTTII
KQSSPVPAGVQPTTALQRPPILQNTIMLGGTPAPPVGTPPPGQVGVAAAQRVTPAGPTPT
GPPPPTAVTPETLENVKKCKNFLSTLIKLASSGKQSSETAANVKELVKNLLHGKICNYHK
NTLKYRDIILEPYRPPLICTYDMRSLPALRQLTPDSVLFIQQSQLPLGTPPAATPPSPAL
TSAVLAGSTPITQRSIAPPTATPTATTKTTSITSTTSSTLTTPTTSAHQPIASLPQHTHS
KPNLVTFSNSYRYTLQQGPMRLLITYTSADIPVLNVRALQILPSCMMKTAVSVGSKVLSV
PGSQSLPSALQKAKLKDAGGATFRVDGALSFPSSLLGWSITSEIEDIQLTISQMNWGEKQ
EKIRNHSPPVLYINISLSSAGKKFGISELGSDVVSIVSHAAQQRLQNLLEKVTQVAQQRN
VPYKEDERHEQVSDVRAQLKFFEQLDQMEKQRKEEQEREILMKAAKSRSRQEDPEQLRLK
QKAKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDSPASGSGPEGVCSAGSGGLCSVGS
GGSRQFSRQRITRVNLRDLLFCLENERDTSRSHLLYKAFLK
Download sequence
Identical sequences W5K5W2
ENSAMXP00000002973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]