SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000004424 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000004424
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-48
Family Calponin-homology domain, CH-domain 0.000000646
Further Details:      
 
Domain Number 2 Region: 248-308
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.57e-18
Family EB1 dimerisation domain-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000004424   Gene: ENSAMXG00000004325   Transcript: ENSAMXT00000004424
Sequence length 334
Comment pep:known_by_projection scaffold:AstMex102:KB871830.1:274118:285544:-1 gene:ENSAMXG00000004325 transcript:ENSAMXT00000004424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPTQALSPNGENNNDILQDNGTNIIPYRKNTVRGERAYSWGMAVNVYSTSITQETMSR
HDITAWVNDLLCLNYTKVEQLSSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKL
LQASFKRMNVDKIIPVEKLVKGRFQDNLDFIQWFKKFFDANYDGKEYDPVQARQGQDAIP
PPDPGEQIFNLPKKSHHAASSPTAGATRSAASSTTPKTSTSTSRPSSAKKIPVLSTTPAK
GEKELEAQVAQLNDQLNTIKLALEGVEKERDFYFGKLREVELLCQEQGQDNGPFVERLME
VLYSTDDQEASAEGEEHEALAQEAEVPDDTQDEY
Download sequence
Identical sequences W5KA13
ENSAMXP00000004424 XP_007234933.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]