SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000004862 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000004862
Domain Number 1 Region: 370-423,461-585
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000667
Family Voltage-gated potassium channels 0.025
Further Details:      
 
Domain Number 2 Region: 612-684
Classification Level Classification E-value
Superfamily EF-hand 0.0000075
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000004862   Gene: ENSAMXG00000004742   Transcript: ENSAMXT00000004862
Sequence length 826
Comment pep:known_by_projection scaffold:AstMex102:KB882154.1:2016754:2027845:-1 gene:ENSAMXG00000004742 transcript:ENSAMXT00000004862 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKLNNRAESHLSSQVECELENLGKRAWVNQAYCGTPPPVHRSISTVYNPQPLFHSQLDS
MGKVSAPNPYPAENSVMNQYHEKKSSGCCSFLLRGIKGLWGTTLTKDTTENRELFVRTTL
RELVVYIVFLVDMCLLTYGMTSSTTYYYTKVMTDLFVNAPSDSGVTFQSIGTMDDFWSYA
QGPLLDGLYWTSWYNNQSLQTGTHSFIYYENMLLGVPRVRQLKVKNKSCKVHKDFEEEIS
DCFDVYNEKKEDDSSFGLINGTAWQYHTEKELKGSNHWGMLATYSGGGYYQDLALTKEES
AGVLANLNNNLWLDHGTRAVFIDFSTYNANINLFCVIRLVVEFPATGGAIPSYQIRTVKL
IRYITTWDYFIIGCEIVFCVFILYYIVEEILELRIHKLSYFKSIWNILDVVIIMLAIVAI
VFNVFRTIKVDKLLGNLLKEPSIYADFEFLAFWQTQYNNMNAVNLFFAWIKIFKYISFNK
TMTQLSSTLARCATDILGFAIMFFIVFFAYAQLGYLLFGTEVESFSTFHKCIFTQFRIIL
GDFDYDGIERANRVLGPIYFFTYVFFVFFVLLNMFLAIINDTYSEVKEELASQKDDLQIT
DLIKQSYSKTFMKLKLKKEKISDVQKVLRSGSKELEFKDFRETLKEMGHADHEISAAFSK
FDYDGNQILDKEEQETMKQELEEKRDALSVELHNLGINYEKNGKETDDNEKTNSVLVTAQ
QFQMLVKQVVELECSLATTMAKIDVVMEKLGLQDAGKTNKKDATGKHLTIRNEQERSVSG
GNVLVNLDRSLGPSWPSAARTGNAGSGLYSDIGWPVVTENSTSSRH
Download sequence
Identical sequences W5KBA1
XP_007252314.1.101067 ENSAMXP00000004862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]