SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000007823 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000007823
Domain Number 1 Region: 1-130
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.63e-48
Family Calponin-homology domain, CH-domain 0.000000484
Further Details:      
 
Domain Number 2 Region: 187-242
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0000000000000275
Family EB1 dimerisation domain-like 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000007823   Gene: ENSAMXG00000007609   Transcript: ENSAMXT00000007823
Sequence length 256
Comment pep:known_by_projection scaffold:AstMex102:KB871688.1:4506944:4510799:1 gene:ENSAMXG00000007609 transcript:ENSAMXT00000007823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVNVYSTSVTSESLSRHDLLTWINSSLRMNHAKIEQLCSGAAYCQFMDMLFPSCVPLKK
VKFQAKLEHEFIFNFKILQASFKKLGVNKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPEAARQGQETATSQSPATAVANKPRKVSSSEARITSVKPTAPVAPQRSTILAPKT
APSADKEELTQMINDLKSTVTVLEQERDFYYGKLMNIERLCLEKGENVDPTLQTILSILY
ADPAEAEGDPGEPEEF
Download sequence
Identical sequences W5KJR1
ENSAMXP00000007823 XP_007231957.1.101067 XP_007231958.1.101067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]