SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000007879 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000007879
Domain Number 1 Region: 947-1085,1113-1325
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.06e-50
Family p120GAP domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 1543-1640
Classification Level Classification E-value
Superfamily RGC domain-like 1.44e-32
Family RGC domain 0.00000471
Further Details:      
 
Domain Number 3 Region: 18-169
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.15e-25
Family Calponin-homology domain, CH-domain 0.00011
Further Details:      
 
Domain Number 4 Region: 602-814
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000149
Family Motor proteins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000007879   Gene: ENSAMXG00000007363   Transcript: ENSAMXT00000007879
Sequence length 1640
Comment pep:known_by_projection scaffold:AstMex102:KB872340.1:90246:150501:-1 gene:ENSAMXG00000007363 transcript:ENSAMXT00000007879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
REREKVSYTVTCNCPNKLHWMEACLNEDLPPTTELEEGLRNGVYLAKLGNFFAPKVVSVK
RIYDREQTRYKVESLVITGPKTNLIKTLTFSPSSPLPPQIFYPETTDIYDRKNMPRCIYC
IHALSLYLFKLGLAPQITDLYGKVAFTEEEINNMKSELEKYNIQMPAFSKIGGILANELS
VDEAALHAAVIAINEAIDHGDPQGTLAAMRNPNAMLLHLDESSAQNYQDTLFQAKAEKVA
NSRKRIGENADAERDVYEELLTQAEIQGNVNKVNVTSALSSMEQALLSGDEDRLFEALLS
PALGLQSLKSKNKGWYLKQLLADREAKEQILTEASKLRMNTCGALIDRSNNKLHNNTALL
LVMVIGALLTFPVGNLTCRSFPVTITYLELKVEPEGFDLYDESDRVLCVHGQGSLTHPEL
LVAVEMLSSVVLINEALDVGDRAAVWKQLSSSVTGLSNVEDEYAQSLILEESFQFIFNVR
LGKIDILVYNGYIHCIQSLHTQHLKNISRIAAIGLINEALDEGDPKKTLEALQHPAAKLT
DVDPSISQHYFNKLLEARREKAHASVRIFMETRDPSAVLWLDEIQEAILRANKDTEEALQ
CKSALNSFSIQYQSSIQSFGCSLSPLSSTTDWVFQYLFIYLLLYIYNRAERCVCWSAGDN
GSEWMKHWVKGGHNYYYNLKTSEGTWDQPADFVQNNKQLNKDEIQSVVSGVTAAYNREQL
WLANESLIAKLQARCRGFLVRRSLKERLRFLETQDPAIKCIQAHWRGYKEKKAFNERKQF
LKDHTEDAVKIQSMVRMHQARKKYRDRLKYFKDHIDDVVKIQAFIRANKARDDYKTLINA
DDPPMAVVRKFVHLLDHSDQDFQEELELMRLREEVITNIRSNQQLENDLNLMDIKIGLLV
KNKITLQEVVSHSKKLTKKNKGELSNLMMMNKQKGGLKALSKEKREKLEAYQYLFYLLQN
ICSAGSVWWSRVLSCGPPNMVLVFLGFWCGSAAGRYPKCEKELQSFHILFLSALKQYQKN
LVDHDQNMIQSQSNPVDARIKFKTLTIAYKLMTEQLLPTCXKTLITKSLDLKIVPDIYKL
FLHQRHDIKDLSLIKLPYDVTPEQAMSHEEVRNRLEASIKNMRTVTDKFLSAIVVSVDKI
PYGMRFIAKVLKDTLHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDAFDIIDMSAGGQ
LTTDQRRNLGSIAKMLQHAASNKMFLGDNAHLNPINEYLTNSYQKFRRFFLAACDVPTLE
EKFNVDQYSDLVTVSKPVIYISIGEIINTHTLLLDHQDAIAPEHNDPIHELLEDLGEVPT
IESLIGENPLPPDDPNKEMMGKTEVSLTLTNKFDVPGEANAEMDAKTLLLNTKRLIVDVI
RFQPGETLSEILETAATPEQEVEYQRAMQRRAIRDAKTPEKMKQTKPVVDDSLTLQGKKD
KIKSNLQRLAELGKVHPENRYQDLINDIAKDIRNQRRYRQRRKAELVKLQQTNSALNTKT
SFYNVQIDYYNQYIKTCMDNLASKGKVSKKPGDNKAKKSKQASQKYTAARLHEKGVLIEI
EDLQTNQFKNVHFEISPSEVVGVFEIKAKFMGVHLETLMLEYQDLLQLQYEGVAVMKLFD
RATVNVNLLIFLLNKKFYGK
Download sequence
Identical sequences W5KJW7
ENSAMXP00000007879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]