SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000008859 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000008859
Domain Number 1 Region: 1474-1688
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000567
Family Tropomyosin 0.0037
Further Details:      
 
Domain Number 2 Region: 1647-1789
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000451
Family Tropomyosin 0.01
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000008859
Domain Number - Region: 1202-1402
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.0046
Further Details:      
 
Domain Number - Region: 512-752
Classification Level Classification E-value
Superfamily Tropomyosin 0.00621
Family Tropomyosin 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000008859   Gene: ENSAMXG00000008587   Transcript: ENSAMXT00000008859
Sequence length 1972
Comment pep:novel scaffold:AstMex102:KB882222.1:394995:429576:1 gene:ENSAMXG00000008587 transcript:ENSAMXT00000008859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFMSAEESMRTEGKLEAVIQKLEESVLSEEKRLTVRGPSPDAPPTCIPARVREIVTKNLN
ESVSLSLSVSGGSMSSVLSLQEENRVLQGELGRLEDLLAHSRADRDELAIKYSAISERLE
QALRLETGDGDRDCAESRSLAQQNVDLRRRLEEEQAAYKRKLTAYQEGQQRQAQLVQKLQ
AKVLQYKKKCSDLEQSLLERSSDMDQNRLSRREEDEPSSELETALIRLEEEQQSRSSSLS
AVNAMLREQLEQASLANEALSQDIRRLTADWTKAREELEQREADWRREEESFHNYFSSEH
SRLLALWRQVVGFRRSVCELKSATERDLSHMRNEMSQVSQTVQLQCVGVCVAVRSREDGS
ALVLEREAAQRTALEQQLRERVTEMMNLQARSDSERAELNNRLAEAVREVERLKARKEER
EYEVASLTRKLEEQSGDEESELMSLRAHTETLLDTLRDIAQAMLSDSDSGVLSSTMEGDS
ENSSLSLLPFLRSPSPQRPSSPRKPSVPPLPESSLSALRSMVTSRQLQLQEVRGRLQSAQ
SSLQQLRKQLAEAESGRREAELRVQAMQGERDDAQRERETAVKERDRMRQEREKINSERD
GLQKAAQAAQTRAELLQLECERLQQAAASAQRERDHEREEREAAVQERERAKAETLRVQT
QWSQSETRGSSQRSELAAVKEALQQGEIEKQLLEAEKNQLTDALSRAESSNAELTVLVAK
LHSEEAALRDSLAKMGGMNESLAQDKSDLNSIIIQLEEEKSVLLTQRREAEQEKLTIRDE
LVRLEQDRLELDTARLALHQQLQESELLRAGLEAELQMIKADRQKLQEKVTQLCGEVSSL
GAELGMVRGEGERQGVALEEAGRSRAELARERAGLVVQLTASERENAALTEELTALRSER
EMLEASLFEVQQQLVQLESRREQIETENNSLRLRSETSTGIQNTQQQCYYIIKSELGLRV
EIAGLNPCQSPERAQLALLSLGSAAELKRLRADRENVVAQGERERAGLKQALADAQQEAQ
TALRNVLNDHQEELERLASEKVLNKPKYSDKPILYNRENSCSSFLGAVLMSASFIIISLL
LEHYSNIHYSLYTCNSTSQCCISSSSKRVSVAPCYTQQYHSIHLGYHINLINHLKPNIKL
FLLLGIYSVYCCQVVAMVSQLVAVVLLGSCLVVARAVQVVSWVVAMVSQVLSRIDSIVLN
VKRQCEEKEQRLTVQDETLASAQKEVGELRSCLREVERSRLEARRELQELRRQVKVVDGE
REQKGREVAELQARLSLEEQREEERGKELFSLKQRLAEAEAGRNSLRKELTSLQKRLCDS
ECVWRGCERDLAAQLQEARGCEKKLQDEARNLSLRAQTAADASAQIQLQLSEAEGRLAAT
EAELTRSEAGRRDLEFRLISLQSALTRTLGISAGGRASRGRSPIGSSHSSLASGVVLRRR
SVSPLRCSLSPPKASRPLSPERGDTPVPLLLPELDSESVRNGLRDFLQELREAQRERDEA
RTQCGALQRELEEVTGERDSAQDRLSQLHNTLQECQEGKRGVDSRLSSTQAMLQQQEECV
RRGERERRALTERVNELERTLQNAETERKHLQEQCSKLRAGEVRLEAERRRLREALEGAE
SRATRVELGRRSLEGEIQRLRVCITERETEAQTAQERHESMLKQVVDAESRVAALQREMD
RLTAVLCKVQDAECVQREKAQTVSLTLQETAAAHSATQGRLATLQKSLSTAEQDRRLLQE
RVDELRAALSEGKHTVASLTERVQTLQSELSQSQLRREELETELSNTQEVCVCLCLRPLP
FSLQQFIAHLFSLQQFIAPPIQPKXILTVCPNTLQTGCLCVCVCAPQVERQKLKTEESSM
RLSAERGRLDLSLNTAEQELQDAQRQISLLQAQLVEMEASHTASEQSARQRDDAQREVER
LRANQREAERTLAARERAHRQRVKGLEEQVSTLKEQLQHELRRRQPSLTPMS
Download sequence
Identical sequences W5KMP7
ENSAMXP00000008859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]