SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000016085 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000016085
Domain Number 1 Region: 30-265
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.32e-78
Family Calponin-homology domain, CH-domain 0.0000809
Further Details:      
 
Domain Number 2 Region: 1335-1447
Classification Level Classification E-value
Superfamily E set domains 7.34e-37
Family Filamin repeat (rod domain) 0.0000205
Further Details:      
 
Domain Number 3 Region: 1140-1256
Classification Level Classification E-value
Superfamily E set domains 2.87e-34
Family Filamin repeat (rod domain) 0.0000918
Further Details:      
 
Domain Number 4 Region: 1535-1643
Classification Level Classification E-value
Superfamily E set domains 6.54e-33
Family Filamin repeat (rod domain) 0.00000602
Further Details:      
 
Domain Number 5 Region: 1067-1161
Classification Level Classification E-value
Superfamily E set domains 2.07e-31
Family Filamin repeat (rod domain) 0.0000111
Further Details:      
 
Domain Number 6 Region: 1438-1540
Classification Level Classification E-value
Superfamily E set domains 6.01e-31
Family Filamin repeat (rod domain) 0.0000319
Further Details:      
 
Domain Number 7 Region: 471-573
Classification Level Classification E-value
Superfamily E set domains 1.13e-30
Family Filamin repeat (rod domain) 0.00088
Further Details:      
 
Domain Number 8 Region: 1246-1356
Classification Level Classification E-value
Superfamily E set domains 2.14e-29
Family Filamin repeat (rod domain) 0.000025
Further Details:      
 
Domain Number 9 Region: 1829-1923
Classification Level Classification E-value
Superfamily E set domains 2.94e-29
Family Filamin repeat (rod domain) 0.00000869
Further Details:      
 
Domain Number 10 Region: 2013-2106
Classification Level Classification E-value
Superfamily E set domains 1.4e-27
Family Filamin repeat (rod domain) 0.000028
Further Details:      
 
Domain Number 11 Region: 670-771
Classification Level Classification E-value
Superfamily E set domains 2.68e-27
Family Filamin repeat (rod domain) 0.00042
Further Details:      
 
Domain Number 12 Region: 381-493
Classification Level Classification E-value
Superfamily E set domains 3.62e-27
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 13 Region: 757-874
Classification Level Classification E-value
Superfamily E set domains 4.27e-27
Family Filamin repeat (rod domain) 0.00079
Further Details:      
 
Domain Number 14 Region: 2288-2379
Classification Level Classification E-value
Superfamily E set domains 1.07e-26
Family Filamin repeat (rod domain) 0.00000876
Further Details:      
 
Domain Number 15 Region: 863-974
Classification Level Classification E-value
Superfamily E set domains 1.53e-25
Family Filamin repeat (rod domain) 0.0005
Further Details:      
 
Domain Number 16 Region: 281-378
Classification Level Classification E-value
Superfamily E set domains 7.34e-25
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 17 Region: 578-670
Classification Level Classification E-value
Superfamily E set domains 8.67e-25
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 18 Region: 2612-2702
Classification Level Classification E-value
Superfamily E set domains 1.27e-24
Family Filamin repeat (rod domain) 0.00000978
Further Details:      
 
Domain Number 19 Region: 951-1064
Classification Level Classification E-value
Superfamily E set domains 2.67e-24
Family Filamin repeat (rod domain) 0.00039
Further Details:      
 
Domain Number 20 Region: 2480-2571
Classification Level Classification E-value
Superfamily E set domains 3.94e-24
Family Filamin repeat (rod domain) 0.0000104
Further Details:      
 
Domain Number 21 Region: 1632-1743
Classification Level Classification E-value
Superfamily E set domains 3.47e-22
Family Filamin repeat (rod domain) 0.0000881
Further Details:      
 
Domain Number 22 Region: 2222-2303
Classification Level Classification E-value
Superfamily E set domains 1.2e-20
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 23 Region: 2387-2477
Classification Level Classification E-value
Superfamily E set domains 2e-20
Family Filamin repeat (rod domain) 0.0000192
Further Details:      
 
Domain Number 24 Region: 1766-1845
Classification Level Classification E-value
Superfamily E set domains 2.2e-16
Family Filamin repeat (rod domain) 0.0000944
Further Details:      
 
Domain Number 25 Region: 1925-2009
Classification Level Classification E-value
Superfamily E set domains 2.27e-16
Family Filamin repeat (rod domain) 0.0000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000016085   Gene: ENSAMXG00000015567   Transcript: ENSAMXT00000016085
Sequence length 2703
Comment pep:known_by_projection scaffold:AstMex102:KB872442.1:24681:59208:-1 gene:ENSAMXG00000015567 transcript:ENSAMXT00000016085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMSHKTSLDDQLPQYHQATDLGEEEDDEMPATEKELAEDAPWKKIQQNTFTRWCNEHLKC
INKNVTDLQRDLGDGLKLIALLEVLSQKKMYRKHHVRPNFRQMKLENVSVALEFLDRERI
KLVSIDSKAIVDGNLKLILGMIWTLILHYSISMPMWDDDDDEEKKKLTPKQRLLGWIQNK
VPQLPINNFNRDWRDGKALGALVDNCAPGLCPDWETWDPNQPVENAREAMQQADDWLGVP
QVIAPEEIVDPDVDEHSVMTYLSQFPKAKLKPGAPVKPRQLHPKKAKAYGPGIEPEGNMV
MKPAVFTVETLDAGLGEVIVYVEDPEGYREEAKVVPNNDKKRTYSVSYVPKVAGPHKVKV
LFAGQDIDKSPFSVNVAKTVGDPNKVQARGPGLEPTGNVTQRPTYFDIYTAGAGAGDVSV
VIVDPQGKKDTVEVILENKGDSVFRCTYQPVLEGPHTIHVSFAGQPIPKSPFKVHISEAS
NASSCRATGRGLQPKGVRVKEVADFRVFTKGAGTGELKVSVKGPGGAEVPVKVRDVGDGV
YECDYRPTVPGKYTVTITWGGQAIPRSPFEVEVGVQAGLQKVRAWGPGLKTGMVGKSADF
VVEAIGTEVGSLGFSIEGPSQAKIECEDKGDGSCDVRYWPTEPGDYAVHVICDDEDIKDS
PFMAHILPAANDVFPEKVRAFGPGLQPTGVIVNMPAEFTIDARQAGKGELKIYAQDAEGC
IIDIKITDKGDGTFVCVYVPKKPIKHTIIISWGGVNVPNSPYRVLVGEGCHPDKVKVYGP
GVEKTGLKSSEPTYFTVDCGEAGQGDISIGIKCAAGVVGTAEADIDFDIIKNDNDTFTVK
YTPPAPGRYTVMVLFAEKEIPSSPYKVKVEPSHDAGKVRAEGPGLNKTGVQVDTPTHFTI
FTKGAGKAKPEVHFSTGQKGNPVKDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPVP
KSPFNISVAPPLDLSKVKVQGLNEKVEVGKDQEFTVNTQGAGGQGNVGVKMVSPSGRPIP
CKLEPDRAKGVTNVKYIPPEEGQYKVDVSYDGNPVPGSPFAVEALMPADPSKVRAYGPGL
KGGIVGKPAPFSIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGTCSVSYLPTEAGDYNIN
ILYGEKHIPGSPFKAAVKPALDASRVTVSGPGLERAKAGEVATFTVDCSRAGEAELTVEI
VSDSGATAEVRIYNNNDGTFSVTYTPQSDGPYTISIRYGGQMVPKCPIRIQVEPAVDTSG
VKVYGPGVEPKGVLRDVTTHFIVDARAQNKMGGNHIRVRIINPSGSNTDTHITDKGDGTY
RVEYTAFEDGLHLIEVFYDEVAVPKSPFRVSVVEGCDPSRVRAYGPGLEGGIVNKPNCFT
VETRGAGAGGLGLTIEGASEAKMSCKDNKDGSCSVEYVPFIPGNYDINITYGGQPIPGSP
FHVLVRDVVDASKVKCSGPGLGSGVRAHVPQTFTVDCSKAGLASLDVKLYGPGGATEPVA
VLNNGDGTHTVNYTPSEEGPYTVAVKYADKDVPRSPFKVHSSPAHDASKVRASGPGLDKA
GVPASLPVEFTIDARDAGEGLLTVQILDPEGKPKKASIQDNKDGTYTVSYVPDVTGRYTI
TIKYGGDQIPFSPYSIQARPTGDASKCLLSVSIGGRGVGSLGPNIQMCEETVISVDAKAA
GTGKVTCKVLTPDGAELDVDVVENLDGTFDIYYTAPEPGKYVITIRFGGQHIPNSPFHVQ
ATKEPVVPRDEKQPQFRPINLLIPFTVQQGALTGEVRMPSGKTARPLIRDNKDGTVTVKY
APTERGLHEMDIKYDGNHIPGSPLQFFVDAAESGMVTAYGPGLCHGTVNKPATFTVVTKN
AAEGGLSLAVEGPSKAEISCKDNKDGTCTVSYLPTAPGDYNIIVKFDGKHIPGSPFTAKI
TGDDSLRTSQLNVGSAADVSLKITETDLSSLTASIRAPSGAEQPCLLKTLPNRHIGLSFT
PKEVGEHEVSVKKSGKHVNNSPFKIMVGPSEIGEASRVRAFGKGLMEAHTFEVAEFFVDT
RNAGYGGLGLSIEGPSKVDIKCEDVEDGTCRVTYCPTEPGNYIINIKFAEKHIPGSPFTV
KVTGEGRMKESIMRKRQAPSIASVGTICDLNLKIPGNWFQMVSAQERLTRTFTRSSHTYT
RTERTEISKTRGGETKREVHVEESTKVGGRDPFRDIFGSILGRESLGCFGSLTSKEVFQS
SSDVQGMTAQVTSPGGKVVNAELVESGDSTYSVRFVPTEMGSHTVSVKYSGQHVPGSPFQ
FTVGPLGEGGPHKVRAGGTGLQRGIAGVPTEFSIWTREAGAGGLSIAVEGPSKAEISFED
RKDGSCGVSYIVQEPGDYEVSIKFNNEHIPDSPFIVPIATLSDDARRLTVTSLQEKDLRV
YQEASFAVQRNGARGVIDAKVHSPSGVVEECYITDVDADKSAIRFIPRENGVHSIDVKFN
GSHIPGSPFNVRVGETGHAGDPGLVSAYGPGLQAGCTGVPAEFVVNTCNAGSGALSVTID
GPSKAKMDCVECAEGYKINYTPMAPGNYLISIKYGGPQHIVGSPFKAKITGVRLSGGHSL
HETSSVLVETMTKSSKVAGAYSSASSSSLSSDGSRVVCQGAGLTRAFIGQKNIFTVDCSK
AGTNMLMVGVHGPRTPCEDVYVKHLGNRLYNVTYTVKEKGNYVVIVKWGDETVPGSPFHV
TVP
Download sequence
Identical sequences W5L8C3
ENSAMXP00000016085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]