SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000017679 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000017679
Domain Number 1 Region: 625-1037
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 5.49e-96
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000112
Further Details:      
 
Domain Number 2 Region: 296-623
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex, superhelical domain 7.19e-69
Family Lipovitellin-phosvitin complex, superhelical domain 0.000000392
Further Details:      
 
Domain Number 3 Region: 27-288
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 8.63e-63
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.0000212
Further Details:      
 
Domain Number 4 Region: 1228-1400
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 1.84e-44
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000017679   Gene: ENSAMXG00000017117   Transcript: ENSAMXT00000017679
Sequence length 1410
Comment pep:known_by_projection scaffold:AstMex102:KB871753.1:385987:409341:-1 gene:ENSAMXG00000017117 transcript:ENSAMXT00000017679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLCSLFVAWAASETINYEPTLNFRKTYEYKYEGVVNVGRGIADLAEAGVKLQCTFRI
TGVSLQTFLLQISDVEFAELNGIVGESYFQVSPSLSKHLTAELNRPFTFEYSKGQVVDIK
TGPEVSNTIVNIVRGILEFLHVTLKTTQRVYELNELGIHGVCHSAYAVEENTADKELYVT
QVVDISNCIQKAAVYSGMTLAEESKNSKQRGENVIATVKYAYTVNSTDTGGVITKASAEE
RHHFSPFNVKGGNTKVKATRNIVLLKVMNTIGKPVTGHVKSRGNLMYKVEKGLGPMPVLL
INVTNPVSKISDLIKHLAEDNIYHVNSATSSNILALIQLLRKTTYDNLELLWAQLSGNAE
HRRWFLDTVVEVTDERVLKFLRSRFKAEDISANEAGQAILLAFNHLSAEPELAEMAKEFL
TIHFSKSHFLLWNTVVLSYGSLLYRMCAGVNSCPVSTVQPLLDMATNGLNKNSEAEMVLA
LKALGNAGHPLSIKTILKFLPGFSVKADSLSTRVQSEAVQSLRHLAVRDPNSVQAIVLTI
FADRTLPAEIRMMASTILLETKPPVALISAVAELLLQEKDLQVGSFIYSQLRAISRSRTP
DNQYLSTACNIAVKVLAQKFGRLSYRYSKALRLDWFHDDFLTGTSSELHLLRNGTGAIPT
QIISKGKLHFIGRILQLVEVGVHTEGLKELFADIPGSTGHFGKADFTAIMRKLLDWKSLP
RNKPLLSAYLRIFGQEVSFLDLNQDVVQLIIKSLTASKENTIWKIIQNLQKGISWRWTKP
YLLLETRFMQPTCLGLPVEMSKYYTALKAITANAKAVINTPPKENLRELLHADISLQTDG
FSGATQDFIVFNGINTDLFQCGLQLNSRIVTALPWKIELKKKAKEWNFEVNLDPCKNATE
LLSVNSNIYAVSRNIEEPSSAKMTPMMPENTNTKQSFPKYEKVPDRFMFSQLLNINSSYD
SVVQVEDSEIIHPKLQFCSESIVFGTAFCTRAEAKRAHYLQEYPLYYFLGFTELSFHLEP
VMSINAIEKIQVQIRVGRNKLKPKQSQMITPTLTEVIIQQLCALLSVPITFMATGLQNQV
SRHATASTNISERMGHFLELSTYVTSPFSSLLNIPQSTVSAIVPKWNHLGMKATRFISKT
NTSHSSRPGSTQPQKSRLISTNVGWVFAFATKEMTDFSKKGEMLCSLYHLYFSNHTFTEG
HSPVYFFHPEPYLYFCILILKGMIAAPDPVISVKLLAISPNEKLLGYEVAAYYTLARQRN
DMELIISEVAEEGNWKICADLSVDRTQEEAKGHFKWGAECQSYEIGLNISGAGLTDTKPS
INAGVNWREVPSFIQVIGKRMREYFPGVSYVMGFSQKHDKNTDHEVSVDFVASSQEGFDV
KVKTPKLTVYRQGIPSPFELVVDESDDSDD
Download sequence
Identical sequences W5LCW7
ENSAMXP00000017679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]