SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000017801 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000017801
Domain Number 1 Region: 435-822
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.99e-129
Family Ankyrin repeat 0.000000000423
Further Details:      
 
Domain Number 2 Region: 191-453
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.52e-73
Family Ankyrin repeat 0.00000333
Further Details:      
 
Domain Number 3 Region: 32-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-48
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 3099-3198
Classification Level Classification E-value
Superfamily DEATH domain 7.74e-24
Family DEATH domain, DD 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000017801   Gene: ENSAMXG00000017269   Transcript: ENSAMXT00000017800
Sequence length 3481
Comment pep:known_by_projection scaffold:AstMex102:KB871658.1:171455:330615:-1 gene:ENSAMXG00000017269 transcript:ENSAMXT00000017800 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQQQLPDLKALEKARERRRRSRERAERRRKSDSNTSFLRAARAGNIDKVLEYLKGGVDI
GTCNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILV
KQGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQ
VVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPL
HIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTR
DGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAP
VDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELL
VKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQV
EVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHIS
AREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGL
TPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNI
LTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKN
GASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHII
NVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTLRVVAEEIITTTTTVTEKHKLNVPE
TMTEVLDVSDEEGDDTMTGDGGEYLRAEDLRELGDDSLPGQYLDGMNYLRFSLEGGRSDR
PLQFSTDRSFTPTHHGYYSPKHDGMGDDAIRNYQVSSLANERDSYRLSWGTENLDNIALS
SSPVHSGFLVSFMVDARGGAMRGCRHNGLRIIIPPRKCSAPTRVTCRLVKRHRLATMPPM
VEGEGLASRLIEVGPSGAQFLGPVIVEIPHFAALRGKERELVILRSETGESWKEHHCEYT
EEELNQILNGMDEELDPPEELERKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGILSS
TVVPQVQAVFPEGALTKRIRVGLQAQSVNMDVVRKILGNKATFSPIVTLEPRRRKFHKPI
TMTIPIPKSSTDPVLNGFGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTFINDCVSFTT
NVSARFWLIDCRQAQESVNFATQVYREIICVPYMAKFVVFAKTHDPIEARLRCFCMTDDK
IDKTLEQQENFTEVARSRDVEVLEGKPIYADCFGNLVPLTKSGQHHLFSFFAFKENRLAL
FIKIRDNTQEPCGRLSFMKEPRSYRSLAHNAICNLNITLPTYSKESDSDQEPDEETVDKM
EDGEDTETSTETSVLKMHLIRESPALASPDLLSEVSEMKQDLIKMSAILTTDPSEKPGPM
QRGDLGKGVEEVSGEPFEIMEKVKEDLEKVSEILRSGTYEDEEKTECRRYRKDEEWVLLS
DCEIEEAKMMAAFETQEPLLKDIRGSRGGQRQKGVKRDSKEYLLDVPVTSGAASQETVVQ
EKFTEVVLRRGGKKIVPTVLKDTKTHVTEVKKPVRRKGPQGHTDESHIPRSKAGSVTENK
GKPQGDDALLSAPSNQKKSPVSPVVEETPIGSIKDKVKALQKKVEEEQKGRKQTGSKPSV
GSSEKKQSPVKTSGPKKSQAPPKSPKTETEKLEDTMSVRELMRAFQTGQDPSKRKSGLFE
HKVASGAKQTKIGQTKETLPTQSLSKTPSLGQEMSLDALEPPKEKELLISPEIRHSKDFS
ADIRAELEDNAEYQQFKKTDLQEKGSCSGLVSSESTVEADIPTGVPQDLSRRRETRPESG
HEHSALDDSSESPKNEGLASPCASVGEGEVHISSEESYKHEGMAESPETSPESLSSPKQP
GQSLLGKVTKVGTVSAKNKKSQESASLSADIADEQASTATLRRSSVKKAVEDPTKSECVS
APRGKSVKFGDEKSPVDKDIPVSSSKPPKSRKLTKRGSETIDSFLSDEESTDVQPASVSA
DSVASRAKTQGHSGLVLHLRHQDSDTISPVADDSLTISHKDSLEGSPLMEDNSSHKSPDS
IEPSPTKESPCCDSLESSPVEQKSTLAFPPTVEQPSVTAGHLTSSKAPEFPPDNLRSRLL
RDQEGSADDDSCEQTSQLTSSGKSPLSPDTPSSEEVSYEVNPKTPDLVVMSVSLKPPVIP
EDAEEDDELECGMTQRKFTPEEEMFKMAAKIKTFDEMEQDAKGKKDNKKDMSSSQTTIGS
EEGLESIKLIWLASKDEKSSVDGLVPAESKQGSEVAQYVETTIKVQPPSPFPAGMHESPQ
RAEDSHQTMAHTAASTDESAKEGPQSVSEKHVTKANQPPQEQKGKGSVSATELEQTTKTS
SSSEGVENITDEQKEESLRKLRGSTDDDSSEKRKDGSKSHSVPEHNITDEVKGDHMKHTG
ASVIDLARDNLRAEADSVPIVIGQSRETFKPEICIYDDTEEDEEEVEPPKTKSRGVTAKT
EADTWSAMREDDDAFAARVREEEQKILGLMVDNHQSQGATPDTTPGRTPTEEGTPTSEQN
PFLFQEGKLFEMTRSGAIDMTKRGYEEEGFAFFQIGEQPIEEALAEDGREESGDVPGAVK
EIKSESAGTVELSSKEAADTSVLSPPEDDQLSSAAKSDASKSRIPIKMGVSASSKTTKKS
PVATSETEEIKSDRLLEDSSSPSGNDLGSPDTVITDVQTAVSTVTRSVYSQQDQESSDSS
PEDQQSVKELPKAPEKKTSPTSEGMSKTKSKSVSKSSATTHKKSTSTSKEEEKPKSRIPV
KAQKSETGQDASMKRAESLKDKKNKLPVKPETRRKSETDTGPSVSSKATRSSKTKSFCES
ESTKKPAKKDQGHPPSTESSSKSKTVPSKLPVRGKPGQPLHTSTPVKKDQPAEKHKQTID
FSEEISDEAAKLVERLAQAEKENEEAAAMSDDESSTVDVSVIESEPFPDMQMPLPEDPLV
IRPRWDDPVETQMERIPADKGQVQSQVDPQEEADRKEGLLAVMADHLGFSWTELARELEI
GEEQINQIRAENPNSLQDQSHALIRLWTEREGATATESTLITMLTKINRMDIVHLIETKI
IQSTQDQSSHTYAEIEQTISLDPSEGFSALHEDMDSPRSGRRTEFTPGRPGSGQEPPIVS
VEDLSSSISSLHDTQKEKLLTDLFLPTIAQDIVSPEEDFSDQECDLIEYSPVSPYFEEFE
ARPSSPESVESEKMFQSESKPTSPESVSSINEFSRLSPDSPIPVFLVPSPVPEKHDLPVF
HQTEAREAKQGPVHADSLESDPEFFDCRQAFSDTSEAEGDEIPEILPQAVTEEQYTDEHG
NIVIKKITRKIIRKFVSADGVEREEVMVEGGQQEAITVDEADSFSKVVKRTVVKSGGDQT
E
Download sequence
Identical sequences W5LD89
ENSAMXP00000017801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]