SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000020132 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000020132
Domain Number 1 Region: 584-719
Classification Level Classification E-value
Superfamily EF-hand 0.0000000372
Family Calmodulin-like 0.051
Further Details:      
 
Domain Number 2 Region: 408-465,503-627
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000942
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000020132   Gene: ENSAMXG00000019444   Transcript: ENSAMXT00000020132
Sequence length 904
Comment pep:known_by_projection scaffold:AstMex102:KB871799.1:471112:482236:1 gene:ENSAMXG00000019444 transcript:ENSAMXT00000020132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSSTRPRSQQQQQQQLHTQPASASLPPSEAIELGTVPHSAPEEQEESPCPPASSSRQAW
SRDNPGFEPEDGLMGASWAPGSPGRRSLSTASSSSSGSSGLDSFSGGSSGRIRGGLSPGR
PAEGMQHGWGKRILAKLRILWGTRLMEDSESSREVYLKNVLRETVTYIFFLITLCIITYG
MVSTNMYFYTKVMSQLFLDTPLSKGDPTTFKTLSTMEDFWKYTEGPFLNGMYWDVWYNNK
SLPENQSLIYYENLLLGVPRLRQVKVLNKSCPVHEDLKDEVYDCYSIYSPASEDKAPFGL
KNNTAWVYSEENILGESSYWGEVATYRGGGYYQDLARSREESARQLKELKDNLWLDRGTR
AVFLDFSVYNGNVNLFCIVRMLVEFPATGGAVTSWQFQTVRLVRYVSSWDYFVGTCEVVF
CLFVLYYMVEEVLEIRLHRLRYFKSLWNCLDVIKVTLSAPAIIMNIYRTSAVSNRLRYLL
ENHSTYPNFQPLAQVQVQFNHLAAVIVFLAWVKLFKFINFNKTMSQLSTTMSRCAKDLLG
FAIMFFIVFLAYAQLAYLVFGNQLNDFSTFQACIFTQFRIILGDFDFSEIEETNRVLGPI
YFTTFVFFMFMILLNMFLAIINDTYSEVKADMAQQRSEMEITDLIKKGYQKAMVKLRLRK
TTVDDISDSLRQAGGKLNFDELRQDLRGKGHSDAEIEAIFAKYDLDGDQELSEHEHQQMK
DDLEKEREDLDLERSSLPRPMSGRSFSRSQDDSEEDDDEDSGHSSRRRGSSSGGVSYEEF
QVLVRRVDRMEHSIGSIVSKIDAVIVKLEAMERAKLKRREVLGRLLDGVMEDERMGRDTE
VHREHMEKLVREELERWESDDAISQVSHQLATPIGAQARIRSARPASSLSTEDPEAGGNG
SGHV
Download sequence
Identical sequences W5LJX0
ENSAMXP00000020132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]