SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000020950 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000020950
Domain Number 1 Region: 1320-1397
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0000573
Further Details:      
 
Domain Number 2 Region: 1277-1335
Classification Level Classification E-value
Superfamily Eea1 homodimerisation domain 7.32e-21
Family Eea1 homodimerisation domain 0.0000871
Further Details:      
 
Domain Number 3 Region: 569-795
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000392
Family Tropomyosin 0.0025
Further Details:      
 
Domain Number 4 Region: 961-1175
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000255
Family Tropomyosin 0.0021
Further Details:      
 
Domain Number 5 Region: 435-633
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000615
Family Tropomyosin 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSAMXP00000020950
Domain Number - Region: 743-971
Classification Level Classification E-value
Superfamily Tropomyosin 0.000314
Family Tropomyosin 0.003
Further Details:      
 
Domain Number - Region: 231-340
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00549
Family Myosin rod fragments 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000020950   Gene: ENSAMXG00000020316   Transcript: ENSAMXT00000020950
Sequence length 1399
Comment pep:known_by_projection scaffold:AstMex102:KB882135.1:2614307:2638535:1 gene:ENSAMXG00000020316 transcript:ENSAMXT00000020950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRILQMTPGKGGSQASESEQPSADMNNETSEGFICPQCMKSHNSAEELFKHYEVYHEP
QEQPSHLSPGRRDDLALLRREVQDLQASLKEERWFSEELKKELDKAQGQLKQQGAQNDGQ
AGTEESELEMKLHEAETEKFNIKQMKDLFEQKAAQLATEIVDIKSRYDEEKSHREVAEQR
LASVQQDLQKERQEKDRLATELLQRPGVEDVDVLKKELVQVQTLMDNMTREREEESERLK
NQYEQLQVNFTNSETTIAQLKAELEKGPQEAAVYTQQIHQLQSNLNNLQQQSQLLSEKLA
RKEKENQELEERLGQEQASKKNLQGSLHQRELELQEVQARASAGESSLGRTQAELTERGE
EAARLRRELAELERSYQELKAERKQLHQQKEEKESQGLQQQSEISQLHAKLLETERQLGE
VQGRLKEQRQLSGEKLKDREQQAAELQLKLSRLDEQLKESATKSTDLQHQLEKSKQQHQE
VQALQQSTNCKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKASLSQLEAEREDLCAK
IQAGEGEAALLNQLQEKNHMLQEQITQFTDKLKNQSESHKQAQENLHEQLQEQKSQLRSA
HDRCQGLERTVTDLTAQLTQSKERLAQLDTQLKAKTEMLLSAEAAKNAQRADLENHLETA
QNALQDKQQELSKVQAQLEEQGCRMQEKQEQCSQLETSLKESRDKLLAAEQKTDTLESQI
KKAEAELTELRSAREQAQKEQQRQQQKTSELEKKNKELGRRLDTEKQGAASLQEEVQKKS
SALADTKKQLEAVEKNRSGLQTSLDQLTKEGKAQQAELEKKLQGQSVELQKVQQERDTQG
KELTSVKEALSKTSATLKESQTQLEKAKKNSAAALEEKEKAHQKAQQELQKSVEATSKEL
STAKSQLEKIAEVEKGLQAQQTALNAQLKQTQDALKEKEKEVQQLQAQLKTAQGSFSQEV
KKLQSQVAELQAAQTQKVEELTKLKEQMTGLSKELSSEKSRCAEVQKTCDSTKETLTKLQ
SDYYGKESEVSAMRQDLKVCEDKLALAQEELVASTNQLNNRDAQIQDLKAARAALEKDLG
KRDEKLKQQEEAIRQLQKQQELTQEQLKKEHSQVEEMREAQSALEKDRSKLSAELKALAD
KSEKEVKELQAAKQLLLQQKVDLQGKVEAAQATLEQEKREHQTTRDSIQQTQQQHKAETD
KLQKQLALEVKAKEEVDKRREDAEAKLTMQVSALNENVATLKREWQGSQRRVGELEKQTD
ELRGEIAVLEATVQNNQDERRALLERCVKGEGEIEKLQGKVVEMRRKLDDTTAAMQELGR
ENQSLQIKQSQSLTRKWAEDNEVQNCMSCGKGFSVTIRKHHCRHCGNIFCAECSARNALT
PSSKKPVRVCEACFEELQG
Download sequence
Identical sequences W5LM88
ENSAMXP00000020950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]