SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSAMXP00000021801 from Astyanax mexicanus 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSAMXP00000021801
Domain Number 1 Region: 405-808
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-137
Family Ankyrin repeat 0.00000000000874
Further Details:      
 
Domain Number 2 Region: 168-423
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.32e-79
Family Ankyrin repeat 0.00000243
Further Details:      
 
Domain Number 3 Region: 13-168
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.08e-41
Family Ankyrin repeat 0.0000767
Further Details:      
 
Domain Number 4 Region: 1418-1501
Classification Level Classification E-value
Superfamily DEATH domain 9.76e-21
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSAMXP00000021801   Gene: ENSAMXG00000021179   Transcript: ENSAMXT00000021801
Sequence length 1965
Comment pep:known_by_projection scaffold:AstMex102:KB871898.1:251257:327844:-1 gene:ENSAMXG00000021179 transcript:ENSAMXT00000021801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSKMVTWGADAATSFLRAARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKM
VLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQ
ENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIA
ARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGI
TPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQA
KTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDK
GAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIV
KILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARM
GHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPL
HVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAAR
NGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQAN
VNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFL
LQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYI
SVIDVLKLVTEETVTMTTTEKHRMSFPETVDEILDVSEDEGVAQLTLGEELLGTEGARYL
KMDDMKDHDEDFLSYKPVLENYSPALPRIPCVSPETVMLKEQEMEQQYTPIPMPKEYDED
SLIPSSPATETSDNVSPVASPIHTGFLVSFMVDARGGSMRGSRHNGLRVIIPPRTCAAPT
RITCRLVKPQKLSTPPPLVEGEGLASRIISLGPAGMQFLGPVIVEIPHFAALGRGDRELV
VLRSENGSVWKEHRNRYGDEVLETILNGMDEDLESQEELGKKRIRRIISTDFPLYFAVVS
RIQQESELIGPEGGHLTSKLLPTVQASFPETAVTKRVRLGLQAQPVPDELVAKLLGNQAT
FSPVVTVEPRRRKFHRPIGLRIPLPPSWRESPRDAGEGDTTSLRLLCSVIGGTAPAQWED
ITGTTKLIYAHDCANFTTNVSARFWLADCPRTAEAVSFANLLYRELSAVPYMAKFVVFAK
MNEVREGRLRCYCMTDDKMDKTLEQHENFTEVARSRDIEVMEGMPLHLECSGNLVPMRKA
TQQPRCFSFQAFRDNRLPVSVKVRDSSKDPSGFLSFLRKSTKYEDSQQVLCNLNITMPPC
IKIVGGEDRRRTLTPLALRERYSALNEPSMATMSAMERTELKMALIAEQLGLSWAELARE
LQFSVDDINKIRVENPNSLLEQSSVLLNLWASREGKRAKMESLYMALKSIDRMDIVNMLE
GQGQQAGQQGGHETSRRRHNERDHLSPGMTNGYGLVVQEELLSPASMQYSLPSPLGHEPY
WQEVSSMECAPIATTEEDTLMEMSEVQVWPSGNSPSLVAVEDSSLECSNADDSEGLLYGS
LGRPGCVTPGGGRTPRGLAGTGGLSGSIELLEDQSIGADSAEHSTAATPSTSGGVNINGL
DRGQGLETDEKAERPAVDEGGSGSGGANGGLGGGGDGTGLEEGLSLISGQQRVYARMSES
PGLSRVADRNGDRSSGGSFLSYLQDQSGPGWHSVQDPIQNWVGSSQSPSPRLAMESMMSS
VRAAVDGDPSQSHLSQEALLQPVRDMGHSEILRGHFRGTQPFEKGLGFPHRVPELRGWEE
MRLRGQGDEAKDLPGEQVREEQFTDEHGNIVTKKIVRKVVRRGKDEEGGQELIIEGLPQE
LDDLDDSEQFVSYAVLGRESMSEVVDVKKGGAQIVKCATLRRVKQ
Download sequence
Identical sequences W5LPK5
XP_007236238.1.101067 ENSAMXP00000021801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]