SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386308986|ref|YP_006005042.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386308986|ref|YP_006005042.1|
Domain Number 1 Region: 24-328
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.47e-69
Family Phosphate binding protein-like 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386308986|ref|YP_006005042.1|
Sequence length 343
Comment ferric iron ABC transporter iron-binding protein [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MKILPLSALVAAGLALSAVTTVVQAEGRLVIYCSATNAMCEEEAKAFGEKYDVKTSFIRN
GSGSTLAKVDAEKKNPQADVWYGGTLDPQSQAGEMDLLYAYASPNLAQIMPQFRDPAKRK
GNYSSAVYIGILGLGVNTDRLKEKGLPEPKCWKDLTNPIYKGEIQIADPQSSGTAYTALA
TFSQLWGEDAAFDYLKKLNANVSQYTKSGIAPARNAARGETTIGIGFLHDYSLEKEKGAP
LKLISPCEGSGYEIGGVSILKGARNLDNAKLFVDWVLSKDAQELAWQKGQSYQILTNTTA
ATSPNSLKLDDLKLINYDMDTYGATEMRKKLITKWVNDVKMGK
Download sequence
Identical sequences A0A0H3NYW1
WP_005165439.1.102102 WP_005165439.1.111 WP_005165439.1.16413 WP_005165439.1.16548 WP_005165439.1.18790 WP_005165439.1.20762 WP_005165439.1.22054 WP_005165439.1.24393 WP_005165439.1.2482 WP_005165439.1.26676 WP_005165439.1.2756 WP_005165439.1.29200 WP_005165439.1.33645 WP_005165439.1.33842 WP_005165439.1.34535 WP_005165439.1.36310 WP_005165439.1.36845 WP_005165439.1.37307 WP_005165439.1.37339 WP_005165439.1.37377 WP_005165439.1.3739 WP_005165439.1.41617 WP_005165439.1.42927 WP_005165439.1.4568 WP_005165439.1.46877 WP_005165439.1.50284 WP_005165439.1.50873 WP_005165439.1.52128 WP_005165439.1.52282 WP_005165439.1.54645 WP_005165439.1.56946 WP_005165439.1.57177 WP_005165439.1.59314 WP_005165439.1.60054 WP_005165439.1.60229 WP_005165439.1.6227 WP_005165439.1.6276 WP_005165439.1.64141 WP_005165439.1.6623 WP_005165439.1.67544 WP_005165439.1.68551 WP_005165439.1.7028 WP_005165439.1.70521 WP_005165439.1.73944 WP_005165439.1.74370 WP_005165439.1.75238 WP_005165439.1.75560 WP_005165439.1.75818 WP_005165439.1.77263 WP_005165439.1.78074 WP_005165439.1.78961 WP_005165439.1.79061 WP_005165439.1.79375 WP_005165439.1.81839 WP_005165439.1.8184 WP_005165439.1.82708 WP_005165439.1.82975 WP_005165439.1.84522 WP_005165439.1.84626 WP_005165439.1.8474 WP_005165439.1.86289 WP_005165439.1.91014 WP_005165439.1.92887 WP_005165439.1.94848 WP_005165439.1.96208 WP_005165439.1.96818 WP_005165439.1.99238 gi|332161244|ref|YP_004297821.1| gi|386308986|ref|YP_006005042.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]