SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386309193|ref|YP_006005249.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386309193|ref|YP_006005249.1|
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.35e-74
Family Phosphate binding protein-like 0.0000000069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386309193|ref|YP_006005249.1|
Sequence length 247
Comment glutamine ABC transporter, periplasmic glutamine-binding protein [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MKSLVKVSLAALALAFAVSSHAAEKELIVATDTAFVPFEFKQGDKYVGFDIDLWDAIAKK
LDLKYTLKPMDFSGIIPALQTKNVDLALAGITITDERKKAVDFSDGYYNSGLLVMVKANN
NDIKGEADLAGKVLAVKSGTGSVDYAKANIKTKDLRQFPNIDNAYLELGTGNADAVLHDT
PNILYFIKTAGNGQFKAVGDSIKAQQYGVAFPQGSDLREKVNAALKSLKEDGTYAAIYKK
WFGVEPK
Download sequence
Identical sequences A0A0B6FCI4 A0A0E1NKJ4 A0A0H3NYM6 A0A0T9KFW4 A0A0T9T5D4 A1JU36
393305.YE2845 gi|123443060|ref|YP_001007034.1| WP_004388693.1.100034 WP_004388693.1.100200 WP_004388693.1.102102 WP_004388693.1.111 WP_004388693.1.11347 WP_004388693.1.12212 WP_004388693.1.13969 WP_004388693.1.13971 WP_004388693.1.14274 WP_004388693.1.15520 WP_004388693.1.16 WP_004388693.1.16413 WP_004388693.1.16548 WP_004388693.1.16723 WP_004388693.1.17047 WP_004388693.1.18790 WP_004388693.1.19087 WP_004388693.1.20762 WP_004388693.1.22054 WP_004388693.1.22156 WP_004388693.1.23689 WP_004388693.1.23750 WP_004388693.1.24393 WP_004388693.1.24455 WP_004388693.1.2482 WP_004388693.1.25150 WP_004388693.1.26676 WP_004388693.1.2681 WP_004388693.1.27215 WP_004388693.1.27291 WP_004388693.1.2756 WP_004388693.1.27645 WP_004388693.1.27663 WP_004388693.1.27965 WP_004388693.1.2833 WP_004388693.1.28488 WP_004388693.1.29173 WP_004388693.1.29200 WP_004388693.1.32200 WP_004388693.1.32298 WP_004388693.1.33645 WP_004388693.1.33697 WP_004388693.1.33842 WP_004388693.1.34535 WP_004388693.1.35647 WP_004388693.1.36310 WP_004388693.1.36845 WP_004388693.1.37307 WP_004388693.1.37339 WP_004388693.1.37377 WP_004388693.1.3739 WP_004388693.1.37392 WP_004388693.1.38467 WP_004388693.1.39120 WP_004388693.1.39701 WP_004388693.1.41617 WP_004388693.1.41645 WP_004388693.1.42927 WP_004388693.1.45624 WP_004388693.1.46310 WP_004388693.1.47151 WP_004388693.1.47289 WP_004388693.1.49096 WP_004388693.1.49172 WP_004388693.1.49903 WP_004388693.1.50873 WP_004388693.1.50913 WP_004388693.1.51324 WP_004388693.1.52128 WP_004388693.1.52282 WP_004388693.1.52510 WP_004388693.1.52530 WP_004388693.1.53745 WP_004388693.1.54645 WP_004388693.1.54893 WP_004388693.1.56946 WP_004388693.1.57177 WP_004388693.1.59297 WP_004388693.1.59314 WP_004388693.1.5946 WP_004388693.1.59817 WP_004388693.1.60054 WP_004388693.1.60229 WP_004388693.1.62658 WP_004388693.1.6276 WP_004388693.1.63044 WP_004388693.1.64141 WP_004388693.1.64144 WP_004388693.1.64607 WP_004388693.1.65310 WP_004388693.1.6623 WP_004388693.1.67007 WP_004388693.1.67544 WP_004388693.1.67688 WP_004388693.1.68551 WP_004388693.1.69335 WP_004388693.1.70167 WP_004388693.1.70254 WP_004388693.1.7028 WP_004388693.1.7032 WP_004388693.1.70348 WP_004388693.1.70521 WP_004388693.1.72301 WP_004388693.1.72703 WP_004388693.1.72721 WP_004388693.1.73937 WP_004388693.1.73944 WP_004388693.1.74271 WP_004388693.1.74370 WP_004388693.1.75090 WP_004388693.1.75238 WP_004388693.1.75560 WP_004388693.1.75818 WP_004388693.1.76565 WP_004388693.1.77263 WP_004388693.1.78074 WP_004388693.1.78943 WP_004388693.1.78961 WP_004388693.1.78974 WP_004388693.1.79061 WP_004388693.1.80565 WP_004388693.1.80986 WP_004388693.1.81200 WP_004388693.1.81865 WP_004388693.1.82708 WP_004388693.1.83529 WP_004388693.1.84522 WP_004388693.1.84626 WP_004388693.1.8474 WP_004388693.1.85518 WP_004388693.1.85569 WP_004388693.1.85647 WP_004388693.1.85902 WP_004388693.1.86289 WP_004388693.1.86434 WP_004388693.1.87836 WP_004388693.1.88911 WP_004388693.1.91014 WP_004388693.1.91311 WP_004388693.1.91446 WP_004388693.1.92887 WP_004388693.1.93960 WP_004388693.1.94591 WP_004388693.1.94794 WP_004388693.1.94848 WP_004388693.1.95393 WP_004388693.1.96208 WP_004388693.1.9637 WP_004388693.1.97152 WP_004388693.1.97603 WP_004388693.1.98085 WP_004388693.1.99238 YP_001007034.1.77335 gi|386309193|ref|YP_006005249.1| gi|332161056|ref|YP_004297633.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]