SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386309230|ref|YP_006005286.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386309230|ref|YP_006005286.1|
Domain Number 1 Region: 44-299
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.72e-48
Family Transferrin 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386309230|ref|YP_006005286.1|
Sequence length 309
Comment phosphonate ABC transporter phosphate-binding periplasmic component [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MKKVLCLTSLLASMMVFNATAADAPKEINLGILGGQNATQQIGDNMCVKEFLDKELNVKT
NLHNASDYSGVIQGLLGGKIDLVLSMSPSSFASVYIKDPKAVDIVGIAIDDTDKSRGYHS
VVVVKADSPYQKIEDLKGKAFGFADPDSTSGFLIPNQVFKQKLGGTADNKYNNFFSSVTF
SGGHEQDILGVINGQFDGAVTWASMIGDYNTGYTSGAFTRMIRMDHPDLMKQIRIIWESP
LIPNGPILVRGALPPEFKAQLVAAVKKLDKEDHACFIKAMGGKQHIGETSLSEYQTIIDM
KRELTKGDR
Download sequence
Identical sequences A0A0H3NSZ1 A0A0H5FIJ0 A0A0T9T3G2
gi|386309230|ref|YP_006005286.1| WP_005158874.1.100034 WP_005158874.1.102102 WP_005158874.1.11347 WP_005158874.1.12212 WP_005158874.1.13969 WP_005158874.1.16413 WP_005158874.1.16548 WP_005158874.1.16723 WP_005158874.1.17047 WP_005158874.1.17975 WP_005158874.1.18790 WP_005158874.1.18893 WP_005158874.1.19087 WP_005158874.1.20762 WP_005158874.1.22054 WP_005158874.1.22156 WP_005158874.1.23689 WP_005158874.1.24393 WP_005158874.1.2482 WP_005158874.1.25150 WP_005158874.1.26415 WP_005158874.1.27291 WP_005158874.1.2756 WP_005158874.1.27954 WP_005158874.1.28488 WP_005158874.1.29173 WP_005158874.1.29200 WP_005158874.1.32298 WP_005158874.1.33645 WP_005158874.1.33842 WP_005158874.1.35647 WP_005158874.1.36310 WP_005158874.1.36845 WP_005158874.1.37307 WP_005158874.1.37339 WP_005158874.1.37377 WP_005158874.1.3739 WP_005158874.1.39701 WP_005158874.1.42927 WP_005158874.1.4568 WP_005158874.1.46310 WP_005158874.1.46877 WP_005158874.1.47151 WP_005158874.1.49096 WP_005158874.1.50284 WP_005158874.1.50913 WP_005158874.1.51802 WP_005158874.1.52128 WP_005158874.1.52282 WP_005158874.1.52510 WP_005158874.1.53745 WP_005158874.1.54645 WP_005158874.1.55167 WP_005158874.1.57251 WP_005158874.1.59314 WP_005158874.1.60054 WP_005158874.1.60229 WP_005158874.1.6227 WP_005158874.1.62658 WP_005158874.1.6276 WP_005158874.1.64141 WP_005158874.1.64607 WP_005158874.1.64724 WP_005158874.1.6623 WP_005158874.1.67544 WP_005158874.1.67688 WP_005158874.1.68551 WP_005158874.1.69335 WP_005158874.1.7028 WP_005158874.1.7032 WP_005158874.1.73937 WP_005158874.1.74370 WP_005158874.1.75238 WP_005158874.1.75560 WP_005158874.1.75717 WP_005158874.1.75818 WP_005158874.1.77079 WP_005158874.1.77263 WP_005158874.1.78074 WP_005158874.1.78943 WP_005158874.1.78961 WP_005158874.1.78974 WP_005158874.1.79150 WP_005158874.1.79299 WP_005158874.1.79375 WP_005158874.1.80565 WP_005158874.1.80986 WP_005158874.1.81839 WP_005158874.1.8184 WP_005158874.1.82708 WP_005158874.1.82975 WP_005158874.1.84522 WP_005158874.1.8474 WP_005158874.1.85569 WP_005158874.1.85902 WP_005158874.1.86289 WP_005158874.1.91014 WP_005158874.1.91362 WP_005158874.1.91446 WP_005158874.1.92887 WP_005158874.1.93960 WP_005158874.1.94848 WP_005158874.1.95393 WP_005158874.1.96208 WP_005158874.1.96818 WP_005158874.1.98085 WP_005158874.1.99238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]