SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386309355|ref|YP_006005411.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386309355|ref|YP_006005411.1|
Domain Number 1 Region: 3-276
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.49e-60
Family Phosphate binding protein-like 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386309355|ref|YP_006005411.1|
Sequence length 304
Comment glutamate Aspartate periplasmic binding protein precursor GltI [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MHMRKLALALLLAGMASGVAHAEDAAKPDASVDTLKKIKDNGVIVVGHRESSVPFSYYDN
QQKVVGYSQDYSNLIVDAIKKKLNAPDLQVKLIPITSQNRIPLLQNGTFDFECGSTTNNL
ERQQQAAFSNTIFVVGTRLLTKKGSEVKDFKELAGKPVVVTSGTTSEVLLNKLNEKDKMN
MRIISAKDHGDSFRTLESGRAVAFMMDDALLAGERAKAKKPDQWDIVGTPQSQEAYGCML
RKDDPAFKTLLDETIATAQTSGVAEKSFDRWFKNPIPPKNLNLNFSLSDEMKVLFKAPND
KALN
Download sequence
Identical sequences A0A0H3NSN7 A0A0H5HHX4
WP_005158411.1.102102 WP_005158411.1.11347 WP_005158411.1.12212 WP_005158411.1.13969 WP_005158411.1.16413 WP_005158411.1.16548 WP_005158411.1.16723 WP_005158411.1.17047 WP_005158411.1.18790 WP_005158411.1.19087 WP_005158411.1.20762 WP_005158411.1.22054 WP_005158411.1.23689 WP_005158411.1.24393 WP_005158411.1.25150 WP_005158411.1.2681 WP_005158411.1.27291 WP_005158411.1.32298 WP_005158411.1.33645 WP_005158411.1.33842 WP_005158411.1.36845 WP_005158411.1.37307 WP_005158411.1.3739 WP_005158411.1.42927 WP_005158411.1.4568 WP_005158411.1.46310 WP_005158411.1.46877 WP_005158411.1.49096 WP_005158411.1.50284 WP_005158411.1.50913 WP_005158411.1.52128 WP_005158411.1.52282 WP_005158411.1.52510 WP_005158411.1.60054 WP_005158411.1.60229 WP_005158411.1.6227 WP_005158411.1.64141 WP_005158411.1.64607 WP_005158411.1.67688 WP_005158411.1.7028 WP_005158411.1.73937 WP_005158411.1.74370 WP_005158411.1.75238 WP_005158411.1.77079 WP_005158411.1.77263 WP_005158411.1.78974 WP_005158411.1.79375 WP_005158411.1.80565 WP_005158411.1.81839 WP_005158411.1.8184 WP_005158411.1.82975 WP_005158411.1.83529 WP_005158411.1.84522 WP_005158411.1.85902 WP_005158411.1.91014 WP_005158411.1.91446 WP_005158411.1.93960 WP_005158411.1.96208 WP_005158411.1.9637 WP_005158411.1.96818 WP_005158411.1.99238 gi|386309355|ref|YP_006005411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]