SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386309389|ref|YP_006005445.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386309389|ref|YP_006005445.1|
Domain Number 1 Region: 5-57
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000851
Family Phosphate binding protein-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386309389|ref|YP_006005445.1|
Sequence length 62
Comment LysR family transcriptional regulator [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MANTCPALSLVNDLSGELKEVLAGHSSGEMPISALWPKNRQLLPKIRYVMDELVRVLNIV
QK
Download sequence
Identical sequences A0A0H3NM80
gi|386309389|ref|YP_006005445.1| WP_005158330.1.102102 WP_005158330.1.12212 WP_005158330.1.16413 WP_005158330.1.16548 WP_005158330.1.18790 WP_005158330.1.19087 WP_005158330.1.20762 WP_005158330.1.22054 WP_005158330.1.24393 WP_005158330.1.2681 WP_005158330.1.27291 WP_005158330.1.32298 WP_005158330.1.33645 WP_005158330.1.33842 WP_005158330.1.36845 WP_005158330.1.37307 WP_005158330.1.3739 WP_005158330.1.42927 WP_005158330.1.4568 WP_005158330.1.46877 WP_005158330.1.50284 WP_005158330.1.52128 WP_005158330.1.52282 WP_005158330.1.60054 WP_005158330.1.60229 WP_005158330.1.6227 WP_005158330.1.64141 WP_005158330.1.7028 WP_005158330.1.74370 WP_005158330.1.75238 WP_005158330.1.77263 WP_005158330.1.78974 WP_005158330.1.79375 WP_005158330.1.81839 WP_005158330.1.8184 WP_005158330.1.82975 WP_005158330.1.83529 WP_005158330.1.84522 WP_005158330.1.85902 WP_005158330.1.91014 WP_005158330.1.96208 WP_005158330.1.9637 WP_005158330.1.96818 WP_005158330.1.99238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]