SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386309544|ref|YP_006005600.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386309544|ref|YP_006005600.1|
Domain Number 1 Region: 44-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.04e-67
Family Phosphate binding protein-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386309544|ref|YP_006005600.1|
Sequence length 330
Comment phosphate ABC transporter substrate-binding protein PstS [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MDIKLMRWGKLALLHALLGFSCGVLALPVAVSPATVVDAPKPDTLSGNLSSVGSDTLANL
MSLWADDFNHHYPGVNLQIQAAGSSTAPAALAAGAAQLGPMSRPMKAAEITAFTERYGYP
PLAVPVAVDALVVFVHQDNPLDKLTLSQLDAVFSQNRRCGESHRIQRFGELGLKEHWAER
SIQRYSRNSASGTYGFFKQLVLCGGDFSNNINELPGSASVVQAVAGSLNGMGYASIGFRN
SGVKPLSLSANGQDYVMPTAENVKDGRYPLSRYLYIYINKAPGKPLEPLTAAFLERVLSP
EGQKRVTHDGYLPLPPEILNHTRKELGFAY
Download sequence
Identical sequences A0A0H3NNU4
gi|386309544|ref|YP_006005600.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]