SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386310180|ref|YP_006006236.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386310180|ref|YP_006006236.1|
Domain Number 1 Region: 27-257
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.28e-48
Family Phosphate binding protein-like 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386310180|ref|YP_006006236.1|
Sequence length 341
Comment glutamate Aspartate periplasmic binding protein precursor GltI [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MKKIMISTLVAAASLVALAGQAHAGTTLDAVKKKGFVQCGISDGLPGFSYADASGKFSGL
DVDICRGVAAAIFGDAEKVKYTPLTAKERFTALQSGEVDILSRNTTWTSSRDAGMGMLFT
GVNYYDGIGFLTHNKAGLKSAKELDGATVCIQAGTDTELNVADYFKANKMQYTPVTFDRS
DESAKALDSGRCDTLASDQSQLYALRIKLGKPDEFIVLPEVISKEPLGPVVRRGDEDWFA
IVRWTLFAMLNAEEMGVTSKNVEELAAKPTTPDMAHLLGQEGNYGKDLKVPNDWVVKIVK
QVGNYGESFDRNVGMGSELKIKRGQNALWNNGGLQYAPPVR
Download sequence
Identical sequences A0A0H3NX76 A0A0H5GY25
gi|386310180|ref|YP_006006236.1| WP_005165196.1.102102 WP_005165196.1.11347 WP_005165196.1.12212 WP_005165196.1.13969 WP_005165196.1.16413 WP_005165196.1.16548 WP_005165196.1.16723 WP_005165196.1.17047 WP_005165196.1.17975 WP_005165196.1.18790 WP_005165196.1.18893 WP_005165196.1.19087 WP_005165196.1.20762 WP_005165196.1.22054 WP_005165196.1.23689 WP_005165196.1.24393 WP_005165196.1.2482 WP_005165196.1.25150 WP_005165196.1.26415 WP_005165196.1.26676 WP_005165196.1.2681 WP_005165196.1.27291 WP_005165196.1.2756 WP_005165196.1.27954 WP_005165196.1.29200 WP_005165196.1.32298 WP_005165196.1.33645 WP_005165196.1.33842 WP_005165196.1.36310 WP_005165196.1.36845 WP_005165196.1.37307 WP_005165196.1.37339 WP_005165196.1.37377 WP_005165196.1.3739 WP_005165196.1.4568 WP_005165196.1.46310 WP_005165196.1.46877 WP_005165196.1.49096 WP_005165196.1.50284 WP_005165196.1.50913 WP_005165196.1.51802 WP_005165196.1.52128 WP_005165196.1.52282 WP_005165196.1.52510 WP_005165196.1.54645 WP_005165196.1.55167 WP_005165196.1.56946 WP_005165196.1.57251 WP_005165196.1.59314 WP_005165196.1.60054 WP_005165196.1.60229 WP_005165196.1.6227 WP_005165196.1.6276 WP_005165196.1.64141 WP_005165196.1.64607 WP_005165196.1.64724 WP_005165196.1.6623 WP_005165196.1.67544 WP_005165196.1.67688 WP_005165196.1.68551 WP_005165196.1.7028 WP_005165196.1.74370 WP_005165196.1.75238 WP_005165196.1.75560 WP_005165196.1.75717 WP_005165196.1.75818 WP_005165196.1.77079 WP_005165196.1.77263 WP_005165196.1.78074 WP_005165196.1.78907 WP_005165196.1.78961 WP_005165196.1.78974 WP_005165196.1.79150 WP_005165196.1.79299 WP_005165196.1.79375 WP_005165196.1.80565 WP_005165196.1.81839 WP_005165196.1.8184 WP_005165196.1.82708 WP_005165196.1.82975 WP_005165196.1.83529 WP_005165196.1.84522 WP_005165196.1.8474 WP_005165196.1.85902 WP_005165196.1.86289 WP_005165196.1.91014 WP_005165196.1.91362 WP_005165196.1.91446 WP_005165196.1.92887 WP_005165196.1.93960 WP_005165196.1.94848 WP_005165196.1.96208 WP_005165196.1.9637 WP_005165196.1.96818 WP_005165196.1.99238 gi|332163168|ref|YP_004299745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]