SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386310281|ref|YP_006006337.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386310281|ref|YP_006006337.1|
Domain Number 1 Region: 21-326
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 5.91e-92
Family Phosphate binding protein-like 0.000000000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386310281|ref|YP_006006337.1|
Sequence length 329
Comment sulfate-binding protein Sbp [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MRKWGVGLSLLLLASGAMAKDIQLLNVSYDPTREFYQEYNQAFSKHWQEQTGDKVTVRQS
HGGSGKQATSVINGIEADVVTLALAYDVDAIAERGRIDKDWIKRLPDNSAPYTSTIVFLV
RKGNPKQIHDWSDLVKPGTSVITPNPKTSGGARWNYLAAWAYALEHNNNDQAKAQEFVKQ
LYKNVEVLDSGARGATNTFVERGIGDVLIAWENEALLAVNEVGKDQFDIITPSISILAEP
TVSVVDKVVDKRGTREVADAYLKYLYSPEGQTIAAKNYYRPRDPAVAAKFAKEFPQLKLI
TIDDVFGGWTKAQQVHFATGGVFDEISKR
Download sequence
Identical sequences A0A0E8M858 A0A0H3NJW1 A1JHZ5
WP_005165336.1.102102 WP_005165336.1.11347 WP_005165336.1.12212 WP_005165336.1.13969 WP_005165336.1.13971 WP_005165336.1.14274 WP_005165336.1.15520 WP_005165336.1.16 WP_005165336.1.16413 WP_005165336.1.16548 WP_005165336.1.16723 WP_005165336.1.17047 WP_005165336.1.17975 WP_005165336.1.18790 WP_005165336.1.18893 WP_005165336.1.19087 WP_005165336.1.20762 WP_005165336.1.22054 WP_005165336.1.23689 WP_005165336.1.24393 WP_005165336.1.24455 WP_005165336.1.2482 WP_005165336.1.25150 WP_005165336.1.26415 WP_005165336.1.2681 WP_005165336.1.27215 WP_005165336.1.27291 WP_005165336.1.2756 WP_005165336.1.27965 WP_005165336.1.29200 WP_005165336.1.32200 WP_005165336.1.32298 WP_005165336.1.33645 WP_005165336.1.33697 WP_005165336.1.33842 WP_005165336.1.34811 WP_005165336.1.36310 WP_005165336.1.36845 WP_005165336.1.37307 WP_005165336.1.37339 WP_005165336.1.37377 WP_005165336.1.3739 WP_005165336.1.37392 WP_005165336.1.38467 WP_005165336.1.39120 WP_005165336.1.39843 WP_005165336.1.41645 WP_005165336.1.42927 WP_005165336.1.4568 WP_005165336.1.46310 WP_005165336.1.46877 WP_005165336.1.47289 WP_005165336.1.49096 WP_005165336.1.50284 WP_005165336.1.50913 WP_005165336.1.51324 WP_005165336.1.52128 WP_005165336.1.52282 WP_005165336.1.52510 WP_005165336.1.52530 WP_005165336.1.54645 WP_005165336.1.55167 WP_005165336.1.56946 WP_005165336.1.57251 WP_005165336.1.59297 WP_005165336.1.59314 WP_005165336.1.59817 WP_005165336.1.60054 WP_005165336.1.60229 WP_005165336.1.6227 WP_005165336.1.6276 WP_005165336.1.63044 WP_005165336.1.64141 WP_005165336.1.64144 WP_005165336.1.64607 WP_005165336.1.65310 WP_005165336.1.6623 WP_005165336.1.67007 WP_005165336.1.67544 WP_005165336.1.67688 WP_005165336.1.68551 WP_005165336.1.70167 WP_005165336.1.7028 WP_005165336.1.70348 WP_005165336.1.72703 WP_005165336.1.73937 WP_005165336.1.74370 WP_005165336.1.75238 WP_005165336.1.75560 WP_005165336.1.75818 WP_005165336.1.76565 WP_005165336.1.77079 WP_005165336.1.77263 WP_005165336.1.78074 WP_005165336.1.78907 WP_005165336.1.78961 WP_005165336.1.78974 WP_005165336.1.79150 WP_005165336.1.79299 WP_005165336.1.79375 WP_005165336.1.80565 WP_005165336.1.81839 WP_005165336.1.8184 WP_005165336.1.81865 WP_005165336.1.82708 WP_005165336.1.82975 WP_005165336.1.83529 WP_005165336.1.84522 WP_005165336.1.8474 WP_005165336.1.85902 WP_005165336.1.86289 WP_005165336.1.86434 WP_005165336.1.87836 WP_005165336.1.88911 WP_005165336.1.91014 WP_005165336.1.91311 WP_005165336.1.91446 WP_005165336.1.92887 WP_005165336.1.93960 WP_005165336.1.94591 WP_005165336.1.94794 WP_005165336.1.94848 WP_005165336.1.95930 WP_005165336.1.96208 WP_005165336.1.9637 WP_005165336.1.96818 WP_005165336.1.97603 WP_005165336.1.99238 YP_001004485.1.77335 393305.YE0091 gi|386310281|ref|YP_006006337.1| gi|123440491|ref|YP_001004485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]