SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386310707|ref|YP_006006763.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386310707|ref|YP_006006763.1|
Domain Number 1 Region: 48-320
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.48e-46
Family Phosphate binding protein-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386310707|ref|YP_006006763.1|
Sequence length 342
Comment taurine-binding periplasmic protein TauA [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MTITFSSVSLASAARGIWRSGGALLALSLVATSAHAVDVTVAYQTSAEPAKVAQADNSFA
KLSGAKVDWRKFDSGSSVVRALASGDVQIGNIGSSPLAVAASQNVPIEVFLLASQLGSSE
ALVVKKEIKTPQDLIGKRIAVPFISTTHYSLLAALKHWGIKPDQVTILNLQPPAIAAAWQ
RGDIDGAYVWAPAVNELAKTGTVLTDSAQVGQWGAPTLDVWVVRKDFAQAHPEVVTAFAR
SALAAQGAYLAQPDQWLKNPEHLSQLSRLSGVPPEQVPELVKGNTYLPVADQITQLGQPV
DQAIRDTAAFLKQQGKIPQVASDYRDFVTDRFVKDVQATPQS
Download sequence
Identical sequences A0A0E1NHV0 A0A0H3NW55 F4N1T9
gi|332163283|ref|YP_004299860.1| gi|386310707|ref|YP_006006763.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]