SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386310888|ref|YP_006006944.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386310888|ref|YP_006006944.1|
Domain Number 1 Region: 4-106
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.29e-20
Family Phosphate binding protein-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386310888|ref|YP_006006944.1|
Sequence length 121
Comment glycerol-3-phosphate ABC transporter substrate-binding protein, partial [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MGYKGVAEFLQFLTQPEIAAEWHQKTGYLPITTAAYELTKQQGFYDKNPGADVATRQMLN
KPPLPYTKGLRLGNMPQIRTVVDEELEGVWTGKKTPQQALDTAVSRGDVLLRRFEQTNKA
I
Download sequence
Identical sequences A0A0H3NZ20
gi|386310888|ref|YP_006006944.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]