SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386311575|ref|YP_006007631.1| from Yersinia enterocolitica subsp. palearctica Y11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386311575|ref|YP_006007631.1|
Domain Number 1 Region: 33-271
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.01e-82
Family Phosphate binding protein-like 0.00000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386311575|ref|YP_006007631.1|
Sequence length 271
Comment methionine ABC transporter substrate-binding protein [Yersinia enterocolitica subsp. palearctica Y11]
Sequence
MSLKFKSIAAVSALIGTLALVGCGPAEKDPNHIKVGVIVGAEQQVAEVAQKVAKDKYGLD
VELVTFNDYVLPNEALSKGDIDLNAFQHKPYLDQQIKDRGYKLVSVGNSFVYPIAGYSKK
IKSLEELQPGSQVALPNDPTNLGRSLLLLEKVGLIKLKDGVGLLPTVLDVVENPKNLKLV
ELEAPQLPRSLDDQQIALAIINTTYASQIGLTPAKDGLFVEDKESPYVNLIVAREDNKDA
ENVKKFVQAYQSDEVNDAANKAFNGGAVKGW
Download sequence
Identical sequences A0A0E1NIJ4 A0A0H3NY03 A1JP49 F4MZC6
WP_005163992.1.100034 WP_005163992.1.102102 WP_005163992.1.111 WP_005163992.1.11347 WP_005163992.1.12212 WP_005163992.1.13969 WP_005163992.1.13971 WP_005163992.1.14274 WP_005163992.1.15520 WP_005163992.1.16 WP_005163992.1.16413 WP_005163992.1.16548 WP_005163992.1.16723 WP_005163992.1.17047 WP_005163992.1.17975 WP_005163992.1.18790 WP_005163992.1.18893 WP_005163992.1.19087 WP_005163992.1.20762 WP_005163992.1.22054 WP_005163992.1.22156 WP_005163992.1.23689 WP_005163992.1.23750 WP_005163992.1.24393 WP_005163992.1.24455 WP_005163992.1.2482 WP_005163992.1.25150 WP_005163992.1.26676 WP_005163992.1.2681 WP_005163992.1.27215 WP_005163992.1.27291 WP_005163992.1.2756 WP_005163992.1.27645 WP_005163992.1.28488 WP_005163992.1.29173 WP_005163992.1.29200 WP_005163992.1.32200 WP_005163992.1.32298 WP_005163992.1.33645 WP_005163992.1.33697 WP_005163992.1.33842 WP_005163992.1.34535 WP_005163992.1.34811 WP_005163992.1.35647 WP_005163992.1.36310 WP_005163992.1.36845 WP_005163992.1.37307 WP_005163992.1.37339 WP_005163992.1.37377 WP_005163992.1.3739 WP_005163992.1.37392 WP_005163992.1.38467 WP_005163992.1.39701 WP_005163992.1.39843 WP_005163992.1.41617 WP_005163992.1.41645 WP_005163992.1.42927 WP_005163992.1.4568 WP_005163992.1.46310 WP_005163992.1.46877 WP_005163992.1.47289 WP_005163992.1.49096 WP_005163992.1.49903 WP_005163992.1.50284 WP_005163992.1.50873 WP_005163992.1.50913 WP_005163992.1.51324 WP_005163992.1.52128 WP_005163992.1.52282 WP_005163992.1.52510 WP_005163992.1.52530 WP_005163992.1.53745 WP_005163992.1.54645 WP_005163992.1.56946 WP_005163992.1.57177 WP_005163992.1.59297 WP_005163992.1.59314 WP_005163992.1.59817 WP_005163992.1.60054 WP_005163992.1.60229 WP_005163992.1.6227 WP_005163992.1.62658 WP_005163992.1.6276 WP_005163992.1.63044 WP_005163992.1.64141 WP_005163992.1.64144 WP_005163992.1.64607 WP_005163992.1.65310 WP_005163992.1.6623 WP_005163992.1.67007 WP_005163992.1.67544 WP_005163992.1.67688 WP_005163992.1.68551 WP_005163992.1.69335 WP_005163992.1.70167 WP_005163992.1.7028 WP_005163992.1.7032 WP_005163992.1.70348 WP_005163992.1.70521 WP_005163992.1.72301 WP_005163992.1.72703 WP_005163992.1.72721 WP_005163992.1.73937 WP_005163992.1.73944 WP_005163992.1.74370 WP_005163992.1.75090 WP_005163992.1.75238 WP_005163992.1.75560 WP_005163992.1.75818 WP_005163992.1.76565 WP_005163992.1.77079 WP_005163992.1.77263 WP_005163992.1.78074 WP_005163992.1.78907 WP_005163992.1.78943 WP_005163992.1.78961 WP_005163992.1.78974 WP_005163992.1.79061 WP_005163992.1.79150 WP_005163992.1.79299 WP_005163992.1.79375 WP_005163992.1.80565 WP_005163992.1.80986 WP_005163992.1.81839 WP_005163992.1.8184 WP_005163992.1.82708 WP_005163992.1.82975 WP_005163992.1.83529 WP_005163992.1.84522 WP_005163992.1.84626 WP_005163992.1.8474 WP_005163992.1.85518 WP_005163992.1.85569 WP_005163992.1.85902 WP_005163992.1.86289 WP_005163992.1.86434 WP_005163992.1.87836 WP_005163992.1.88911 WP_005163992.1.91014 WP_005163992.1.91311 WP_005163992.1.91446 WP_005163992.1.92887 WP_005163992.1.93960 WP_005163992.1.94591 WP_005163992.1.94794 WP_005163992.1.94848 WP_005163992.1.95393 WP_005163992.1.95930 WP_005163992.1.96208 WP_005163992.1.9637 WP_005163992.1.96818 WP_005163992.1.97603 WP_005163992.1.98085 WP_005163992.1.99238 YP_001007429.1.77335 gi|123443456|ref|YP_001007429.1| 393305.YE3255 gi|386311575|ref|YP_006007631.1| gi|332160621|ref|YP_004297198.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]