SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188996043|ref|YP_001930294.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188996043|ref|YP_001930294.1|
Domain Number 1 Region: 10-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.61e-52
Family PP-loop ATPase 0.0000129
Further Details:      
 
Domain Number 2 Region: 331-445
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.8e-22
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0086
Further Details:      
 
Domain Number 3 Region: 213-314
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 1.96e-16
Family MesJ substrate recognition domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188996043|ref|YP_001930294.1|
Sequence length 457
Comment tRNA(Ile)-lysidine synthetase [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MTMLESKFLKAVRKFNLIENQDKILIAFSGGPDSLVLTNLLLKFQKTLNIAKIQLAHLNH
TLRKESDQDQEFCEKFASSLGLKIHVKKADVKKVAREQKISVEEAGRLERYKFFNEILQK
ENLNKIATGHHLSDLTESIVLWFIQGNKRGLKGFRPKENNIIRPLYLITKEEIEEYCQKN
GLEYLIDQSNFSRKYLRNQVRLDVIPILKKINPDLENSMLNLSQLSYFDEFYLDKLTEEY
YSQLDNKNLLDLSFINKLPNALKYRLLIKWIYENTDTYPSYKQILNLMEILDKQGQKEIK
ISRDIKVVKTYDKLEISTSENMENLQIEYKLKVGQKIFLKEFCMELESYVIDAKDFKKDN
NTECFDLPEDSILEIRTRKEGDRFLPFNRKTEKKIKDVFIDLKIPKYVRDSIPLLVYNNK
ILWIIGYKRSGYYPVSENSTKVICFRYKEVHNNCYFL
Download sequence
Identical sequences B2V6K8
436114.SYO3AOP1_0093 WP_012458832.1.9181 gi|188996043|ref|YP_001930294.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]