SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188996990|ref|YP_001931241.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|188996990|ref|YP_001931241.1|
Domain Number - Region: 62-154
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 0.0183
Family MJ1460-like 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188996990|ref|YP_001931241.1|
Sequence length 178
Comment hypothetical protein SYO3AOP1_1068 [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MAEIKGEINQEVINTLIDLTKAIIGEKAVDNIVKSVMEKNKENCTGRDIVFAFADEVQNM
FGQKGGYAIIRQLGREVAKSLMEKHPKEEWEDLLEKSLNAFGFAYKIERNSNEAYICNCV
FYEGALKPRGLGPIEHCVCWCGWGFIEAFVRGLEEGVKGIKWEERDYENQKCKFVFLR
Download sequence
Identical sequences B2V9R4
436114.SYO3AOP1_1068 WP_012459755.1.9181 gi|188996990|ref|YP_001931241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]