SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|188997584|ref|YP_001931835.1| from Sulfurihydrogenibium sp. YO3AOP1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188997584|ref|YP_001931835.1|
Domain Number 1 Region: 195-384
Classification Level Classification E-value
Superfamily PheT/TilS domain 9.16e-69
Family B3/B4 domain of PheRS, PheT 0.0000161
Further Details:      
 
Domain Number 2 Region: 460-680
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.47e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00026
Further Details:      
 
Domain Number 3 Region: 41-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.71e-32
Family Myf domain 0.011
Further Details:      
 
Domain Number 4 Region: 707-793
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 5.62e-20
Family Anticodon-binding domain of PheRS 0.0006
Further Details:      
 
Domain Number 5 Region: 395-468
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000156
Family Domains B1 and B5 of PheRS-beta, PheT 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188997584|ref|YP_001931835.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase subunit beta [Sulfurihydrogenibium sp. YO3AOP1]
Sequence
MKVPYSWIKEFIDIDIPVSDVVVKLNTTGIEATFYKFGQYIPNLTTVKVLSVIKHPEKDK
LYICKVSDGSREYQIITGADNVKENDVVILAKVGALIKGREIKAVSFGSYTSEGMLLSLE
ELEVEEKSEGIFILDENTPVGADPNKILGLGEDYILEIEITPNRGDALSVRGLAREIGAI
FNLKRKEIQPKPVLTDKETAINIETDKVYRYIGTIIKNVKIKNSPLDVRLKLIKSGISVI
NNIVDITNYVLLQEGQPLHAFDLDKLEGGITVRYAKEGEKIITLDGQEKELKPTDVVIAD
SKKALAIAGVIGGENSKIDENTKNILLEAAVFDPASVRKTSKRLGILTDSSYRFERGVDV
EHTSKASNFATQLILNLAGGEVEAYKDVYVKPYTPKTVVLKPEFVEKVLGEKIKASEIKS
TLERLEIPTQIQENQINAEIPPFRAYDLERPIDLIEEVARIYGYDNFTPTYPRVPVEAYE
KSLYYDFDNKVRTYFLDNGFTEVLNYTFTSEEIYNALKLPIPEIKITNYILKSHSILRDR
IVVSLLENLKENLRFGRKDLSIFELSSTFFKDFEEIRVGCLAVGKLVEGFNYTEKERRFS
TTHSWNFLKLKGVVENLLNKLGIKNYQLTDENIEVFLHPYGSANIQVNGYDIGFIGKIHP
EIAHKLEIPKDTYVAELKLRHVPREIEKESLLDGYLFTYYLKKEPVVFQELPKFPSAYRD
LAFVIDESVKVGKLKEDILKASKYVKEVKLFDVYFLSENKKSVAFNVEFFNPEKSLSDEE
VNIIVEEILNKLKLNYPDISLRT
Download sequence
Identical sequences B2V6U9
WP_012460337.1.9181 gi|188997584|ref|YP_001931835.1| 436114.SYO3AOP1_1683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]