SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184200295|ref|YP_001854502.1| from Kocuria rhizophila DC2201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184200295|ref|YP_001854502.1|
Domain Number 1 Region: 4-182
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.71e-43
Family Phosphoglucomutase, first 3 domains 0.0004
Further Details:      
 
Domain Number 2 Region: 259-367
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.47e-29
Family Phosphoglucomutase, first 3 domains 0.0082
Further Details:      
 
Domain Number 3 Region: 159-256
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.49e-25
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 4 Region: 359-448
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 5.62e-23
Family Phosphoglucomutase, C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|184200295|ref|YP_001854502.1|
Sequence length 451
Comment phosphoglucosamine mutase [Kocuria rhizophila DC2201]
Sequence
MSRIFGTDGVRGLANGLLTAELAMELSQAAAIVLGHRHAPEGQRPTAVVARDGRASGEFI
GAAVTAGLASSGVDVYDAGVLPTPAAAYLVGDIDADFGVMISASHNPAPDNGIKFLAHGG
KKLPDAVEDTIQQVYEAKDFVRPTGAEVGRVTRLSDAEDRYILHLVGAIPHRLDGLSIVL
DCANGAASGASPDAFRDAGATVHVIGAEPDGLNINDGVGSTHLGPLKQAVRELGADLGIA
HDGDADRCLAVDHTGTEVDGDQIMCILAVAMKEAGRLNQDTLVATVMSNLGLQLALDEAG
ITLVRASVGDRYVLESMVANGYNLGGEQSGHVIMADYATTGDGLLTGLMLASRVAQTGMP
LQELARTMTRMPQVMINVKNVDKAAAKTSEPVLEAVARTEERLGAEGRVLLRPSGTEPVV
RVMVEAATHEDARREAEQLVSAVEEHLSLQS
Download sequence
Identical sequences B2GJ26
378753.KRH_06490 WP_012397721.1.5541 WP_012397721.1.84478 WP_012397721.1.8702 gi|184200295|ref|YP_001854502.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]