SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184200811|ref|YP_001855018.1| from Kocuria rhizophila DC2201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184200811|ref|YP_001855018.1|
Domain Number 1 Region: 7-201
Classification Level Classification E-value
Superfamily Formyltransferase 6.15e-46
Family Formyltransferase 0.0000188
Further Details:      
 
Domain Number 2 Region: 209-307
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 7.69e-26
Family Post formyltransferase domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|184200811|ref|YP_001855018.1|
Sequence length 312
Comment methionyl-tRNA formyltransferase [Kocuria rhizophila DC2201]
Sequence
MSGTALPIVYAGTPETAVAPLEALHEDPRIEVRAVLTREDAPVGRKRVMTPSAVGRRAEE
LGLPVLKANRVTPEVQQALRAKGARIGAVVAYGALLPRPALDVFEHGWINLHFSLLPQWR
GAAPVQRALMAGDTVVGASTFVLDEGMDTGPVVGTLTDKVREEDTAGTVLARLAREGSPL
LAESLLGVASEAVHPEAQRGEPSAAPKLTGADARITWQHPAVAVAHHVRGVTPEPGAWTE
FEGQRLKVDRVVPAPGVTGIAPGHVVIREKRVYAGTGSYAVELTRVQPGGKKPMAALDWA
RGTQHREQVAFT
Download sequence
Identical sequences B2GGT9
378753.KRH_11650 gi|184200811|ref|YP_001855018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]