SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184201794|ref|YP_001856001.1| from Kocuria rhizophila DC2201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184201794|ref|YP_001856001.1|
Domain Number 1 Region: 107-301
Classification Level Classification E-value
Superfamily Formyltransferase 7.98e-63
Family Formyltransferase 0.00012
Further Details:      
 
Domain Number 2 Region: 22-102
Classification Level Classification E-value
Superfamily ACT-like 2.71e-16
Family SP0238-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|184201794|ref|YP_001856001.1|
Sequence length 302
Comment formyltetrahydrofolate deformylase [Kocuria rhizophila DC2201]
Sequence
MSTPQPVTSAAAPGAEPRTRELVLTLDCPEQPGIVHAVSGVLLEHGANIVELTQYDDRRV
GHFFMRVHMAPTEGAALDQQSLREDLTPVAERFGMRWELHEHGAKRRVLVMVSKFGHCLN
DLLFRARTGELPVEIVAVVSNHLDHQRLVEWHGIPFFHVPVTKDTKPEAEARLLDLVDRF
EVDLVVLARYMQVLSDSLATRMEGRVINIHHSFLPSFKGAKPYHQAYDRGVKTVGATAHY
VNAELDEGPIITQQVVEVNHAYGPEDLVAAGRDTECKALSDAVRWHCEGRVILHGAKTVV
LR
Download sequence
Identical sequences B2GHY3
378753.KRH_21480 gi|184201794|ref|YP_001856001.1| WP_012399216.1.5541 WP_012399216.1.84478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]