SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184201982|ref|YP_001856189.1| from Kocuria rhizophila DC2201

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184201982|ref|YP_001856189.1|
Domain Number 1 Region: 58-148
Classification Level Classification E-value
Superfamily Ribosomal protein L9 C-domain 1.31e-20
Family Ribosomal protein L9 C-domain 0.00094
Further Details:      
 
Domain Number 2 Region: 3-58
Classification Level Classification E-value
Superfamily L9 N-domain-like 3.66e-17
Family Ribosomal protein L9 N-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|184201982|ref|YP_001856189.1|
Sequence length 149
Comment 50S ribosomal protein L9 [Kocuria rhizophila DC2201]
Sequence
MAKIILTQEVSGLGSAGDVVDVKNGYARNFLFPRGFATPWSRGAEKQIESIKQARAAREL
SSLEDAQALAAKLTSTTLTVPVTAGAEGRLFGTVRAGDIASAVENAGLGSIDKRRVDLTQ
RIKTTGVYQAVVHLHEDVNANVEFEVVPA
Download sequence
Identical sequences A0A0B4DE20 A0A1E8UE21 B2GJD5
gi|184201982|ref|YP_001856189.1| WP_012399404.1.11345 WP_012399404.1.4208 WP_012399404.1.49080 WP_012399404.1.5541 WP_012399404.1.69945 WP_012399404.1.80783 WP_012399404.1.84478 378753.KRH_23360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]