SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|184158075|ref|YP_001846414.1| from Acinetobacter baumannii ACICU

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|184158075|ref|YP_001846414.1|
Domain Number 1 Region: 57-336
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.56e-39
Family Phosphate binding protein-like 0.028
Further Details:      
 
Domain Number 2 Region: 383-472
Classification Level Classification E-value
Superfamily NosL/MerB-like 0.000000000497
Family NosL-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|184158075|ref|YP_001846414.1|
Sequence length 476
Comment nitrate/sulfonate/bicarbonate ABC transporter periplasmic protein [Acinetobacter baumannii ACICU]
Sequence
MRQNKLINKKLLLSSLIGAMVLGTLGCGSKTETVRVAIGTQDTTINCATGGLLIRELNLL
PKYLPKDGKYKHVKYDIQWKNFTSGAPLTSEMVAGRLDLGAMADFPAVNNLAAFKKAGKE
SIFLAPLSGSINGSGNAIVVPIDSKVTSLKELKGQTISVPFASTAHGLLLRAIQAEGWQL
DKDIKVIAQAPEVAGPALKSHKISAHADFVPFGELFAYQGFAKKIYDGSQAKSPTFHGSL
ASKDYAQQHPEVIKAYLQATIEANRLIQEQPEKYSEIIAEKTGIPAEVVYLFHGPLGLQT
RDLTWKPEYRKATQIAIDTLKVLGKNDGTLDVNKFIDDQYIKDAFQASGLNYSQQLADYA
KSPLVANDALTGQPIKTFDRVTQIWVKGEEKVRSYETPEHAFSDLKKIQADGKTVRVVYS
QDHQSDIKLLANLAWYATDKTGQIQAFLLKDDAEKWAKQQGGKVYDFKAIQLVTQS
Download sequence
Identical sequences A0A009I5Q7 A0A009RIQ2 A0A062DIT7 A0A062FHW7 A0A0E1PX91 A0A0R1BGU9 A0A219C8H7 L9P1K0
gi|407932786|ref|YP_006848429.1| 405416.ACICU_01755 gi|523527171|ref|YP_008213202.1| gi|184158075|ref|YP_001846414.1| gi|384132174|ref|YP_005514786.1| gi|387123969|ref|YP_006289851.1| gi|385237516|ref|YP_005798855.1| WP_001249637.1.100119 WP_001249637.1.100136 WP_001249637.1.100157 WP_001249637.1.100211 WP_001249637.1.100222 WP_001249637.1.100238 WP_001249637.1.100290 WP_001249637.1.1003 WP_001249637.1.100380 WP_001249637.1.100406 WP_001249637.1.100568 WP_001249637.1.10058 WP_001249637.1.100616 WP_001249637.1.100656 WP_001249637.1.100957 WP_001249637.1.100971 WP_001249637.1.101001 WP_001249637.1.101005 WP_001249637.1.101012 WP_001249637.1.101037 WP_001249637.1.101100 WP_001249637.1.101243 WP_001249637.1.101254 WP_001249637.1.101258 WP_001249637.1.101276 WP_001249637.1.10136 WP_001249637.1.1014 WP_001249637.1.101413 WP_001249637.1.10147 WP_001249637.1.101574 WP_001249637.1.101742 WP_001249637.1.101810 WP_001249637.1.101850 WP_001249637.1.101885 WP_001249637.1.101910 WP_001249637.1.101976 WP_001249637.1.101995 WP_001249637.1.102023 WP_001249637.1.102110 WP_001249637.1.10328 WP_001249637.1.10375 WP_001249637.1.10466 WP_001249637.1.10512 WP_001249637.1.10649 WP_001249637.1.10725 WP_001249637.1.10768 WP_001249637.1.10777 WP_001249637.1.1080 WP_001249637.1.10838 WP_001249637.1.10852 WP_001249637.1.10909 WP_001249637.1.11003 WP_001249637.1.1101 WP_001249637.1.11016 WP_001249637.1.11090 WP_001249637.1.11203 WP_001249637.1.11307 WP_001249637.1.11308 WP_001249637.1.11374 WP_001249637.1.1138 WP_001249637.1.1155 WP_001249637.1.11698 WP_001249637.1.11910 WP_001249637.1.11923 WP_001249637.1.11925 WP_001249637.1.1216 WP_001249637.1.12250 WP_001249637.1.12322 WP_001249637.1.12414 WP_001249637.1.12529 WP_001249637.1.12617 WP_001249637.1.12638 WP_001249637.1.1270 WP_001249637.1.12702 WP_001249637.1.12796 WP_001249637.1.1283 WP_001249637.1.12974 WP_001249637.1.13047 WP_001249637.1.13078 WP_001249637.1.13137 WP_001249637.1.1317 WP_001249637.1.13195 WP_001249637.1.13220 WP_001249637.1.13236 WP_001249637.1.13485 WP_001249637.1.13516 WP_001249637.1.13521 WP_001249637.1.13651 WP_001249637.1.13699 WP_001249637.1.13761 WP_001249637.1.13821 WP_001249637.1.13871 WP_001249637.1.13894 WP_001249637.1.1390 WP_001249637.1.13916 WP_001249637.1.1396 WP_001249637.1.14020 WP_001249637.1.1411 WP_001249637.1.14187 WP_001249637.1.14271 WP_001249637.1.14311 WP_001249637.1.14354 WP_001249637.1.14357 WP_001249637.1.14385 WP_001249637.1.14392 WP_001249637.1.14479 WP_001249637.1.14650 WP_001249637.1.14700 WP_001249637.1.14801 WP_001249637.1.14829 WP_001249637.1.14853 WP_001249637.1.14909 WP_001249637.1.14939 WP_001249637.1.15152 WP_001249637.1.15166 WP_001249637.1.15383 WP_001249637.1.15462 WP_001249637.1.15465 WP_001249637.1.15497 WP_001249637.1.15653 WP_001249637.1.15695 WP_001249637.1.15778 WP_001249637.1.15793 WP_001249637.1.15821 WP_001249637.1.15947 WP_001249637.1.16011 WP_001249637.1.16178 WP_001249637.1.16325 WP_001249637.1.16371 WP_001249637.1.1639 WP_001249637.1.16411 WP_001249637.1.16434 WP_001249637.1.16510 WP_001249637.1.1656 WP_001249637.1.16576 WP_001249637.1.16579 WP_001249637.1.16607 WP_001249637.1.16610 WP_001249637.1.16699 WP_001249637.1.16717 WP_001249637.1.16864 WP_001249637.1.16993 WP_001249637.1.17021 WP_001249637.1.17244 WP_001249637.1.17433 WP_001249637.1.17468 WP_001249637.1.17492 WP_001249637.1.17632 WP_001249637.1.17646 WP_001249637.1.17664 WP_001249637.1.17752 WP_001249637.1.17781 WP_001249637.1.17999 WP_001249637.1.18082 WP_001249637.1.18091 WP_001249637.1.18238 WP_001249637.1.18302 WP_001249637.1.18325 WP_001249637.1.18385 WP_001249637.1.18546 WP_001249637.1.18755 WP_001249637.1.1910 WP_001249637.1.19120 WP_001249637.1.19131 WP_001249637.1.1916 WP_001249637.1.19292 WP_001249637.1.19339 WP_001249637.1.19396 WP_001249637.1.19475 WP_001249637.1.19531 WP_001249637.1.19670 WP_001249637.1.19826 WP_001249637.1.19877 WP_001249637.1.1995 WP_001249637.1.20044 WP_001249637.1.20120 WP_001249637.1.20176 WP_001249637.1.20194 WP_001249637.1.20306 WP_001249637.1.2033 WP_001249637.1.20359 WP_001249637.1.2039 WP_001249637.1.20444 WP_001249637.1.20534 WP_001249637.1.20541 WP_001249637.1.20571 WP_001249637.1.20656 WP_001249637.1.20748 WP_001249637.1.20807 WP_001249637.1.20816 WP_001249637.1.20817 WP_001249637.1.20830 WP_001249637.1.20889 WP_001249637.1.20998 WP_001249637.1.21032 WP_001249637.1.21112 WP_001249637.1.21117 WP_001249637.1.21190 WP_001249637.1.21337 WP_001249637.1.21484 WP_001249637.1.21546 WP_001249637.1.21689 WP_001249637.1.21738 WP_001249637.1.21747 WP_001249637.1.21939 WP_001249637.1.22047 WP_001249637.1.22053 WP_001249637.1.22104 WP_001249637.1.22108 WP_001249637.1.22209 WP_001249637.1.22286 WP_001249637.1.22349 WP_001249637.1.22452 WP_001249637.1.22469 WP_001249637.1.22515 WP_001249637.1.22586 WP_001249637.1.22687 WP_001249637.1.23141 WP_001249637.1.23173 WP_001249637.1.23188 WP_001249637.1.23243 WP_001249637.1.23328 WP_001249637.1.23401 WP_001249637.1.23636 WP_001249637.1.23651 WP_001249637.1.23669 WP_001249637.1.2386 WP_001249637.1.23975 WP_001249637.1.24015 WP_001249637.1.24097 WP_001249637.1.24105 WP_001249637.1.24152 WP_001249637.1.24178 WP_001249637.1.24260 WP_001249637.1.24358 WP_001249637.1.24373 WP_001249637.1.24449 WP_001249637.1.24545 WP_001249637.1.24621 WP_001249637.1.24706 WP_001249637.1.24744 WP_001249637.1.24927 WP_001249637.1.25091 WP_001249637.1.25143 WP_001249637.1.25263 WP_001249637.1.25292 WP_001249637.1.25519 WP_001249637.1.25524 WP_001249637.1.25560 WP_001249637.1.2559 WP_001249637.1.2561 WP_001249637.1.25689 WP_001249637.1.25723 WP_001249637.1.25810 WP_001249637.1.2585 WP_001249637.1.25850 WP_001249637.1.25971 WP_001249637.1.26181 WP_001249637.1.26204 WP_001249637.1.2626 WP_001249637.1.26425 WP_001249637.1.26436 WP_001249637.1.26472 WP_001249637.1.26504 WP_001249637.1.26528 WP_001249637.1.26649 WP_001249637.1.26669 WP_001249637.1.26678 WP_001249637.1.26744 WP_001249637.1.27059 WP_001249637.1.27109 WP_001249637.1.27176 WP_001249637.1.27265 WP_001249637.1.27270 WP_001249637.1.273 WP_001249637.1.2730 WP_001249637.1.27346 WP_001249637.1.2736 WP_001249637.1.27509 WP_001249637.1.27531 WP_001249637.1.2762 WP_001249637.1.2769 WP_001249637.1.27704 WP_001249637.1.27731 WP_001249637.1.27801 WP_001249637.1.27845 WP_001249637.1.27852 WP_001249637.1.27934 WP_001249637.1.27983 WP_001249637.1.28048 WP_001249637.1.28101 WP_001249637.1.28141 WP_001249637.1.28204 WP_001249637.1.28320 WP_001249637.1.28385 WP_001249637.1.28405 WP_001249637.1.28411 WP_001249637.1.28456 WP_001249637.1.28507 WP_001249637.1.28513 WP_001249637.1.28601 WP_001249637.1.28677 WP_001249637.1.28898 WP_001249637.1.28929 WP_001249637.1.28937 WP_001249637.1.28988 WP_001249637.1.29074 WP_001249637.1.29117 WP_001249637.1.29123 WP_001249637.1.29216 WP_001249637.1.29229 WP_001249637.1.29347 WP_001249637.1.29362 WP_001249637.1.29434 WP_001249637.1.29455 WP_001249637.1.29552 WP_001249637.1.2979 WP_001249637.1.29817 WP_001249637.1.29824 WP_001249637.1.29897 WP_001249637.1.30026 WP_001249637.1.30083 WP_001249637.1.30161 WP_001249637.1.30309 WP_001249637.1.30407 WP_001249637.1.30490 WP_001249637.1.30611 WP_001249637.1.30667 WP_001249637.1.30673 WP_001249637.1.3075 WP_001249637.1.30776 WP_001249637.1.30856 WP_001249637.1.30932 WP_001249637.1.30969 WP_001249637.1.30978 WP_001249637.1.30996 WP_001249637.1.31141 WP_001249637.1.31328 WP_001249637.1.31430 WP_001249637.1.3144 WP_001249637.1.3162 WP_001249637.1.3163 WP_001249637.1.31729 WP_001249637.1.31810 WP_001249637.1.31834 WP_001249637.1.3198 WP_001249637.1.31980 WP_001249637.1.32028 WP_001249637.1.32065 WP_001249637.1.32129 WP_001249637.1.32257 WP_001249637.1.32272 WP_001249637.1.32304 WP_001249637.1.32374 WP_001249637.1.32386 WP_001249637.1.32487 WP_001249637.1.32579 WP_001249637.1.32682 WP_001249637.1.32773 WP_001249637.1.3280 WP_001249637.1.32830 WP_001249637.1.32847 WP_001249637.1.32956 WP_001249637.1.3303 WP_001249637.1.33104 WP_001249637.1.33154 WP_001249637.1.33198 WP_001249637.1.33262 WP_001249637.1.33370 WP_001249637.1.33386 WP_001249637.1.33447 WP_001249637.1.3346 WP_001249637.1.33495 WP_001249637.1.33541 WP_001249637.1.33558 WP_001249637.1.33706 WP_001249637.1.33714 WP_001249637.1.33777 WP_001249637.1.33805 WP_001249637.1.33869 WP_001249637.1.33902 WP_001249637.1.33929 WP_001249637.1.33931 WP_001249637.1.33978 WP_001249637.1.34027 WP_001249637.1.34045 WP_001249637.1.34049 WP_001249637.1.34207 WP_001249637.1.34394 WP_001249637.1.34618 WP_001249637.1.34642 WP_001249637.1.34859 WP_001249637.1.34986 WP_001249637.1.35000 WP_001249637.1.35018 WP_001249637.1.35046 WP_001249637.1.35250 WP_001249637.1.35327 WP_001249637.1.3535 WP_001249637.1.35461 WP_001249637.1.35558 WP_001249637.1.35588 WP_001249637.1.35601 WP_001249637.1.35715 WP_001249637.1.35717 WP_001249637.1.35728 WP_001249637.1.35758 WP_001249637.1.35761 WP_001249637.1.35828 WP_001249637.1.35883 WP_001249637.1.35912 WP_001249637.1.36327 WP_001249637.1.36355 WP_001249637.1.36358 WP_001249637.1.36359 WP_001249637.1.36418 WP_001249637.1.36517 WP_001249637.1.36569 WP_001249637.1.36694 WP_001249637.1.36714 WP_001249637.1.36882 WP_001249637.1.36909 WP_001249637.1.36938 WP_001249637.1.37007 WP_001249637.1.3712 WP_001249637.1.37180 WP_001249637.1.37212 WP_001249637.1.37215 WP_001249637.1.37437 WP_001249637.1.3758 WP_001249637.1.37603 WP_001249637.1.37680 WP_001249637.1.37695 WP_001249637.1.37729 WP_001249637.1.37893 WP_001249637.1.37963 WP_001249637.1.37982 WP_001249637.1.38009 WP_001249637.1.38122 WP_001249637.1.38249 WP_001249637.1.38320 WP_001249637.1.3837 WP_001249637.1.3843 WP_001249637.1.3861 WP_001249637.1.38628 WP_001249637.1.38696 WP_001249637.1.38732 WP_001249637.1.38748 WP_001249637.1.38779 WP_001249637.1.38901 WP_001249637.1.38964 WP_001249637.1.39019 WP_001249637.1.39353 WP_001249637.1.39399 WP_001249637.1.39598 WP_001249637.1.39680 WP_001249637.1.39688 WP_001249637.1.397 WP_001249637.1.3974 WP_001249637.1.39911 WP_001249637.1.39928 WP_001249637.1.40199 WP_001249637.1.40200 WP_001249637.1.40225 WP_001249637.1.40233 WP_001249637.1.40297 WP_001249637.1.40332 WP_001249637.1.4047 WP_001249637.1.40490 WP_001249637.1.40547 WP_001249637.1.40679 WP_001249637.1.40832 WP_001249637.1.40836 WP_001249637.1.4086 WP_001249637.1.40864 WP_001249637.1.40947 WP_001249637.1.41029 WP_001249637.1.41059 WP_001249637.1.4110 WP_001249637.1.41201 WP_001249637.1.41266 WP_001249637.1.41395 WP_001249637.1.41425 WP_001249637.1.41507 WP_001249637.1.41546 WP_001249637.1.4164 WP_001249637.1.41707 WP_001249637.1.41720 WP_001249637.1.41738 WP_001249637.1.41777 WP_001249637.1.41838 WP_001249637.1.41922 WP_001249637.1.41934 WP_001249637.1.41936 WP_001249637.1.42080 WP_001249637.1.42172 WP_001249637.1.42253 WP_001249637.1.42289 WP_001249637.1.42351 WP_001249637.1.42401 WP_001249637.1.42484 WP_001249637.1.42531 WP_001249637.1.42561 WP_001249637.1.42571 WP_001249637.1.42765 WP_001249637.1.4277 WP_001249637.1.42773 WP_001249637.1.42824 WP_001249637.1.42888 WP_001249637.1.42928 WP_001249637.1.43011 WP_001249637.1.43028 WP_001249637.1.43094 WP_001249637.1.431 WP_001249637.1.4311 WP_001249637.1.43175 WP_001249637.1.43194 WP_001249637.1.43203 WP_001249637.1.43227 WP_001249637.1.43340 WP_001249637.1.43380 WP_001249637.1.43439 WP_001249637.1.43641 WP_001249637.1.43645 WP_001249637.1.43751 WP_001249637.1.43759 WP_001249637.1.4396 WP_001249637.1.43978 WP_001249637.1.44009 WP_001249637.1.44342 WP_001249637.1.44370 WP_001249637.1.44372 WP_001249637.1.44407 WP_001249637.1.44538 WP_001249637.1.44613 WP_001249637.1.44664 WP_001249637.1.44684 WP_001249637.1.44770 WP_001249637.1.44809 WP_001249637.1.44816 WP_001249637.1.44886 WP_001249637.1.44926 WP_001249637.1.44929 WP_001249637.1.44944 WP_001249637.1.44974 WP_001249637.1.44991 WP_001249637.1.45149 WP_001249637.1.45233 WP_001249637.1.45291 WP_001249637.1.45350 WP_001249637.1.4537 WP_001249637.1.45399 WP_001249637.1.45457 WP_001249637.1.45587 WP_001249637.1.45637 WP_001249637.1.45647 WP_001249637.1.45675 WP_001249637.1.45761 WP_001249637.1.45839 WP_001249637.1.45916 WP_001249637.1.46108 WP_001249637.1.46138 WP_001249637.1.46194 WP_001249637.1.46209 WP_001249637.1.46246 WP_001249637.1.46255 WP_001249637.1.46258 WP_001249637.1.46338 WP_001249637.1.46385 WP_001249637.1.46392 WP_001249637.1.46413 WP_001249637.1.46474 WP_001249637.1.4648 WP_001249637.1.46493 WP_001249637.1.46518 WP_001249637.1.46577 WP_001249637.1.46739 WP_001249637.1.46762 WP_001249637.1.46774 WP_001249637.1.46827 WP_001249637.1.4683 WP_001249637.1.46850 WP_001249637.1.46918 WP_001249637.1.46950 WP_001249637.1.46959 WP_001249637.1.47241 WP_001249637.1.47298 WP_001249637.1.47388 WP_001249637.1.47475 WP_001249637.1.47515 WP_001249637.1.47543 WP_001249637.1.47552 WP_001249637.1.47715 WP_001249637.1.47816 WP_001249637.1.47828 WP_001249637.1.47863 WP_001249637.1.47903 WP_001249637.1.47917 WP_001249637.1.48042 WP_001249637.1.48115 WP_001249637.1.4819 WP_001249637.1.4824 WP_001249637.1.48280 WP_001249637.1.48380 WP_001249637.1.48415 WP_001249637.1.48457 WP_001249637.1.48509 WP_001249637.1.48642 WP_001249637.1.48692 WP_001249637.1.48700 WP_001249637.1.48785 WP_001249637.1.48824 WP_001249637.1.489 WP_001249637.1.48988 WP_001249637.1.49083 WP_001249637.1.4911 WP_001249637.1.49261 WP_001249637.1.49318 WP_001249637.1.4935 WP_001249637.1.49405 WP_001249637.1.4941 WP_001249637.1.49564 WP_001249637.1.49639 WP_001249637.1.4967 WP_001249637.1.49705 WP_001249637.1.49789 WP_001249637.1.49849 WP_001249637.1.49866 WP_001249637.1.49896 WP_001249637.1.49928 WP_001249637.1.49960 WP_001249637.1.49992 WP_001249637.1.50011 WP_001249637.1.50097 WP_001249637.1.50208 WP_001249637.1.50223 WP_001249637.1.50267 WP_001249637.1.50298 WP_001249637.1.503 WP_001249637.1.50617 WP_001249637.1.50641 WP_001249637.1.50705 WP_001249637.1.50789 WP_001249637.1.50815 WP_001249637.1.50851 WP_001249637.1.50859 WP_001249637.1.50867 WP_001249637.1.50872 WP_001249637.1.51063 WP_001249637.1.51303 WP_001249637.1.51328 WP_001249637.1.51369 WP_001249637.1.51437 WP_001249637.1.51569 WP_001249637.1.51578 WP_001249637.1.51663 WP_001249637.1.5171 WP_001249637.1.51856 WP_001249637.1.51861 WP_001249637.1.5193 WP_001249637.1.51966 WP_001249637.1.52032 WP_001249637.1.5206 WP_001249637.1.52103 WP_001249637.1.52138 WP_001249637.1.52189 WP_001249637.1.5220 WP_001249637.1.52325 WP_001249637.1.52392 WP_001249637.1.52445 WP_001249637.1.52619 WP_001249637.1.5274 WP_001249637.1.52769 WP_001249637.1.52779 WP_001249637.1.5281 WP_001249637.1.52837 WP_001249637.1.52839 WP_001249637.1.52885 WP_001249637.1.52980 WP_001249637.1.52982 WP_001249637.1.53023 WP_001249637.1.53052 WP_001249637.1.53097 WP_001249637.1.53146 WP_001249637.1.53331 WP_001249637.1.53390 WP_001249637.1.53424 WP_001249637.1.53498 WP_001249637.1.53533 WP_001249637.1.53593 WP_001249637.1.53616 WP_001249637.1.53762 WP_001249637.1.53854 WP_001249637.1.53954 WP_001249637.1.54 WP_001249637.1.54055 WP_001249637.1.54088 WP_001249637.1.5412 WP_001249637.1.54139 WP_001249637.1.54242 WP_001249637.1.54352 WP_001249637.1.54361 WP_001249637.1.54451 WP_001249637.1.54566 WP_001249637.1.54581 WP_001249637.1.54664 WP_001249637.1.54741 WP_001249637.1.54761 WP_001249637.1.5489 WP_001249637.1.54963 WP_001249637.1.54977 WP_001249637.1.55062 WP_001249637.1.55096 WP_001249637.1.55155 WP_001249637.1.55201 WP_001249637.1.55321 WP_001249637.1.55363 WP_001249637.1.55368 WP_001249637.1.55376 WP_001249637.1.55516 WP_001249637.1.55638 WP_001249637.1.55773 WP_001249637.1.55799 WP_001249637.1.55952 WP_001249637.1.55997 WP_001249637.1.56027 WP_001249637.1.56067 WP_001249637.1.56076 WP_001249637.1.56102 WP_001249637.1.56165 WP_001249637.1.56211 WP_001249637.1.56246 WP_001249637.1.56668 WP_001249637.1.56712 WP_001249637.1.56717 WP_001249637.1.56833 WP_001249637.1.56841 WP_001249637.1.5697 WP_001249637.1.57078 WP_001249637.1.57346 WP_001249637.1.57408 WP_001249637.1.57457 WP_001249637.1.57465 WP_001249637.1.57535 WP_001249637.1.57543 WP_001249637.1.57606 WP_001249637.1.57654 WP_001249637.1.5769 WP_001249637.1.5780 WP_001249637.1.57829 WP_001249637.1.57874 WP_001249637.1.58061 WP_001249637.1.58115 WP_001249637.1.5822 WP_001249637.1.58269 WP_001249637.1.58337 WP_001249637.1.58453 WP_001249637.1.58506 WP_001249637.1.58621 WP_001249637.1.58969 WP_001249637.1.590 WP_001249637.1.59078 WP_001249637.1.5908 WP_001249637.1.59107 WP_001249637.1.59325 WP_001249637.1.59416 WP_001249637.1.59476 WP_001249637.1.59488 WP_001249637.1.59522 WP_001249637.1.5961 WP_001249637.1.59649 WP_001249637.1.59754 WP_001249637.1.59765 WP_001249637.1.59897 WP_001249637.1.59957 WP_001249637.1.600 WP_001249637.1.60059 WP_001249637.1.60099 WP_001249637.1.60108 WP_001249637.1.60116 WP_001249637.1.60198 WP_001249637.1.60243 WP_001249637.1.60299 WP_001249637.1.60316 WP_001249637.1.60318 WP_001249637.1.60359 WP_001249637.1.60371 WP_001249637.1.60474 WP_001249637.1.60581 WP_001249637.1.60589 WP_001249637.1.60609 WP_001249637.1.60616 WP_001249637.1.60655 WP_001249637.1.60669 WP_001249637.1.60697 WP_001249637.1.61105 WP_001249637.1.61291 WP_001249637.1.61336 WP_001249637.1.61410 WP_001249637.1.61452 WP_001249637.1.61477 WP_001249637.1.61527 WP_001249637.1.61578 WP_001249637.1.61637 WP_001249637.1.61704 WP_001249637.1.61974 WP_001249637.1.62011 WP_001249637.1.62150 WP_001249637.1.62191 WP_001249637.1.62308 WP_001249637.1.62368 WP_001249637.1.624 WP_001249637.1.62428 WP_001249637.1.62543 WP_001249637.1.6257 WP_001249637.1.62712 WP_001249637.1.62767 WP_001249637.1.6277 WP_001249637.1.62868 WP_001249637.1.62924 WP_001249637.1.62935 WP_001249637.1.63028 WP_001249637.1.63219 WP_001249637.1.63252 WP_001249637.1.63303 WP_001249637.1.63340 WP_001249637.1.63391 WP_001249637.1.63405 WP_001249637.1.63426 WP_001249637.1.63429 WP_001249637.1.6352 WP_001249637.1.63609 WP_001249637.1.63636 WP_001249637.1.63639 WP_001249637.1.63681 WP_001249637.1.63857 WP_001249637.1.63933 WP_001249637.1.64129 WP_001249637.1.64218 WP_001249637.1.64310 WP_001249637.1.64428 WP_001249637.1.64465 WP_001249637.1.64604 WP_001249637.1.64639 WP_001249637.1.64834 WP_001249637.1.64907 WP_001249637.1.64955 WP_001249637.1.65003 WP_001249637.1.65005 WP_001249637.1.65058 WP_001249637.1.6513 WP_001249637.1.6519 WP_001249637.1.65267 WP_001249637.1.65325 WP_001249637.1.65342 WP_001249637.1.65373 WP_001249637.1.65496 WP_001249637.1.65560 WP_001249637.1.65592 WP_001249637.1.65630 WP_001249637.1.65680 WP_001249637.1.65804 WP_001249637.1.65890 WP_001249637.1.65939 WP_001249637.1.65955 WP_001249637.1.65995 WP_001249637.1.66140 WP_001249637.1.66142 WP_001249637.1.66189 WP_001249637.1.66200 WP_001249637.1.66210 WP_001249637.1.66215 WP_001249637.1.66431 WP_001249637.1.66458 WP_001249637.1.66491 WP_001249637.1.66496 WP_001249637.1.66541 WP_001249637.1.66591 WP_001249637.1.66636 WP_001249637.1.66689 WP_001249637.1.66716 WP_001249637.1.66717 WP_001249637.1.66782 WP_001249637.1.66806 WP_001249637.1.66899 WP_001249637.1.67361 WP_001249637.1.67426 WP_001249637.1.67486 WP_001249637.1.67597 WP_001249637.1.67656 WP_001249637.1.6767 WP_001249637.1.67728 WP_001249637.1.67862 WP_001249637.1.67869 WP_001249637.1.67922 WP_001249637.1.67939 WP_001249637.1.68065 WP_001249637.1.68087 WP_001249637.1.68119 WP_001249637.1.68132 WP_001249637.1.68168 WP_001249637.1.68225 WP_001249637.1.68315 WP_001249637.1.6841 WP_001249637.1.68428 WP_001249637.1.68454 WP_001249637.1.6851 WP_001249637.1.6861 WP_001249637.1.68698 WP_001249637.1.68830 WP_001249637.1.68837 WP_001249637.1.68858 WP_001249637.1.68885 WP_001249637.1.689 WP_001249637.1.68930 WP_001249637.1.69117 WP_001249637.1.69121 WP_001249637.1.69193 WP_001249637.1.69242 WP_001249637.1.69257 WP_001249637.1.69364 WP_001249637.1.69379 WP_001249637.1.69419 WP_001249637.1.69424 WP_001249637.1.69458 WP_001249637.1.69478 WP_001249637.1.6952 WP_001249637.1.69568 WP_001249637.1.69586 WP_001249637.1.69665 WP_001249637.1.69815 WP_001249637.1.69929 WP_001249637.1.69930 WP_001249637.1.70025 WP_001249637.1.70154 WP_001249637.1.70283 WP_001249637.1.70354 WP_001249637.1.70542 WP_001249637.1.70739 WP_001249637.1.70891 WP_001249637.1.71151 WP_001249637.1.71168 WP_001249637.1.71204 WP_001249637.1.71220 WP_001249637.1.71539 WP_001249637.1.71650 WP_001249637.1.71719 WP_001249637.1.71796 WP_001249637.1.71823 WP_001249637.1.71825 WP_001249637.1.71857 WP_001249637.1.71876 WP_001249637.1.71960 WP_001249637.1.71969 WP_001249637.1.71971 WP_001249637.1.72084 WP_001249637.1.7213 WP_001249637.1.72158 WP_001249637.1.72265 WP_001249637.1.72295 WP_001249637.1.72317 WP_001249637.1.72334 WP_001249637.1.72430 WP_001249637.1.7244 WP_001249637.1.72538 WP_001249637.1.72997 WP_001249637.1.73076 WP_001249637.1.73146 WP_001249637.1.73341 WP_001249637.1.73348 WP_001249637.1.73375 WP_001249637.1.73434 WP_001249637.1.73446 WP_001249637.1.73542 WP_001249637.1.73645 WP_001249637.1.73820 WP_001249637.1.73867 WP_001249637.1.73875 WP_001249637.1.73932 WP_001249637.1.74122 WP_001249637.1.74312 WP_001249637.1.74424 WP_001249637.1.74463 WP_001249637.1.7453 WP_001249637.1.74700 WP_001249637.1.74709 WP_001249637.1.74711 WP_001249637.1.74819 WP_001249637.1.74838 WP_001249637.1.74869 WP_001249637.1.74930 WP_001249637.1.75104 WP_001249637.1.75105 WP_001249637.1.75107 WP_001249637.1.75121 WP_001249637.1.75212 WP_001249637.1.75225 WP_001249637.1.75386 WP_001249637.1.75412 WP_001249637.1.75459 WP_001249637.1.75489 WP_001249637.1.75562 WP_001249637.1.75569 WP_001249637.1.75738 WP_001249637.1.75812 WP_001249637.1.75859 WP_001249637.1.75895 WP_001249637.1.75939 WP_001249637.1.76026 WP_001249637.1.76101 WP_001249637.1.76117 WP_001249637.1.76216 WP_001249637.1.76250 WP_001249637.1.76260 WP_001249637.1.76372 WP_001249637.1.76464 WP_001249637.1.76493 WP_001249637.1.76523 WP_001249637.1.76587 WP_001249637.1.7662 WP_001249637.1.76682 WP_001249637.1.76787 WP_001249637.1.76809 WP_001249637.1.76871 WP_001249637.1.76953 WP_001249637.1.76981 WP_001249637.1.77237 WP_001249637.1.77257 WP_001249637.1.77274 WP_001249637.1.77347 WP_001249637.1.77539 WP_001249637.1.7757 WP_001249637.1.77634 WP_001249637.1.77711 WP_001249637.1.77758 WP_001249637.1.77787 WP_001249637.1.77815 WP_001249637.1.77891 WP_001249637.1.77903 WP_001249637.1.7791 WP_001249637.1.77996 WP_001249637.1.78042 WP_001249637.1.7816 WP_001249637.1.7825 WP_001249637.1.78261 WP_001249637.1.78263 WP_001249637.1.78355 WP_001249637.1.78505 WP_001249637.1.7864 WP_001249637.1.7866 WP_001249637.1.78660 WP_001249637.1.78769 WP_001249637.1.78783 WP_001249637.1.78805 WP_001249637.1.78808 WP_001249637.1.78988 WP_001249637.1.79010 WP_001249637.1.79028 WP_001249637.1.79072 WP_001249637.1.79078 WP_001249637.1.79181 WP_001249637.1.79229 WP_001249637.1.79260 WP_001249637.1.79261 WP_001249637.1.79284 WP_001249637.1.793 WP_001249637.1.7938 WP_001249637.1.79405 WP_001249637.1.7949 WP_001249637.1.79701 WP_001249637.1.79720 WP_001249637.1.79728 WP_001249637.1.79736 WP_001249637.1.79774 WP_001249637.1.7978 WP_001249637.1.79889 WP_001249637.1.79909 WP_001249637.1.79938 WP_001249637.1.80092 WP_001249637.1.80121 WP_001249637.1.80125 WP_001249637.1.80143 WP_001249637.1.80162 WP_001249637.1.80195 WP_001249637.1.8021 WP_001249637.1.80665 WP_001249637.1.80730 WP_001249637.1.80887 WP_001249637.1.80897 WP_001249637.1.80987 WP_001249637.1.80997 WP_001249637.1.81002 WP_001249637.1.81068 WP_001249637.1.81161 WP_001249637.1.81240 WP_001249637.1.81253 WP_001249637.1.81319 WP_001249637.1.81345 WP_001249637.1.81412 WP_001249637.1.81441 WP_001249637.1.81466 WP_001249637.1.81700 WP_001249637.1.81704 WP_001249637.1.81764 WP_001249637.1.82039 WP_001249637.1.82082 WP_001249637.1.82090 WP_001249637.1.82110 WP_001249637.1.82203 WP_001249637.1.82286 WP_001249637.1.8230 WP_001249637.1.82366 WP_001249637.1.82453 WP_001249637.1.82504 WP_001249637.1.82538 WP_001249637.1.82561 WP_001249637.1.82786 WP_001249637.1.828 WP_001249637.1.82809 WP_001249637.1.82848 WP_001249637.1.82861 WP_001249637.1.83001 WP_001249637.1.8301 WP_001249637.1.83098 WP_001249637.1.8312 WP_001249637.1.83178 WP_001249637.1.83400 WP_001249637.1.83410 WP_001249637.1.83450 WP_001249637.1.83474 WP_001249637.1.83594 WP_001249637.1.836 WP_001249637.1.8377 WP_001249637.1.838 WP_001249637.1.83889 WP_001249637.1.84012 WP_001249637.1.84058 WP_001249637.1.84139 WP_001249637.1.84171 WP_001249637.1.84247 WP_001249637.1.84250 WP_001249637.1.84308 WP_001249637.1.84332 WP_001249637.1.84387 WP_001249637.1.84447 WP_001249637.1.84490 WP_001249637.1.84527 WP_001249637.1.84536 WP_001249637.1.84550 WP_001249637.1.84571 WP_001249637.1.84618 WP_001249637.1.84688 WP_001249637.1.84691 WP_001249637.1.84706 WP_001249637.1.8472 WP_001249637.1.84769 WP_001249637.1.84864 WP_001249637.1.84898 WP_001249637.1.84921 WP_001249637.1.84944 WP_001249637.1.85101 WP_001249637.1.85149 WP_001249637.1.85158 WP_001249637.1.85168 WP_001249637.1.85185 WP_001249637.1.85299 WP_001249637.1.85472 WP_001249637.1.85493 WP_001249637.1.85544 WP_001249637.1.85616 WP_001249637.1.85711 WP_001249637.1.85743 WP_001249637.1.85833 WP_001249637.1.85846 WP_001249637.1.85889 WP_001249637.1.85922 WP_001249637.1.8596 WP_001249637.1.8601 WP_001249637.1.86131 WP_001249637.1.86277 WP_001249637.1.86324 WP_001249637.1.86385 WP_001249637.1.86536 WP_001249637.1.86715 WP_001249637.1.86890 WP_001249637.1.86908 WP_001249637.1.86966 WP_001249637.1.86973 WP_001249637.1.86976 WP_001249637.1.87048 WP_001249637.1.87099 WP_001249637.1.87111 WP_001249637.1.87156 WP_001249637.1.87312 WP_001249637.1.87545 WP_001249637.1.87567 WP_001249637.1.87598 WP_001249637.1.87688 WP_001249637.1.87717 WP_001249637.1.87727 WP_001249637.1.87746 WP_001249637.1.87830 WP_001249637.1.88109 WP_001249637.1.88115 WP_001249637.1.88131 WP_001249637.1.88133 WP_001249637.1.88163 WP_001249637.1.88183 WP_001249637.1.88512 WP_001249637.1.88596 WP_001249637.1.88613 WP_001249637.1.88654 WP_001249637.1.88842 WP_001249637.1.88956 WP_001249637.1.89172 WP_001249637.1.89199 WP_001249637.1.89209 WP_001249637.1.89218 WP_001249637.1.89289 WP_001249637.1.89376 WP_001249637.1.89383 WP_001249637.1.89419 WP_001249637.1.89459 WP_001249637.1.89484 WP_001249637.1.89568 WP_001249637.1.89611 WP_001249637.1.89653 WP_001249637.1.89685 WP_001249637.1.89790 WP_001249637.1.89792 WP_001249637.1.89836 WP_001249637.1.89878 WP_001249637.1.9 WP_001249637.1.90087 WP_001249637.1.90118 WP_001249637.1.90132 WP_001249637.1.90262 WP_001249637.1.90310 WP_001249637.1.9038 WP_001249637.1.90413 WP_001249637.1.90593 WP_001249637.1.90656 WP_001249637.1.90697 WP_001249637.1.90704 WP_001249637.1.90743 WP_001249637.1.90755 WP_001249637.1.90932 WP_001249637.1.90953 WP_001249637.1.91085 WP_001249637.1.91147 WP_001249637.1.91206 WP_001249637.1.91249 WP_001249637.1.91286 WP_001249637.1.91299 WP_001249637.1.91335 WP_001249637.1.9134 WP_001249637.1.91355 WP_001249637.1.91477 WP_001249637.1.91502 WP_001249637.1.91523 WP_001249637.1.9154 WP_001249637.1.91696 WP_001249637.1.9172 WP_001249637.1.91762 WP_001249637.1.91780 WP_001249637.1.91789 WP_001249637.1.91854 WP_001249637.1.91908 WP_001249637.1.91941 WP_001249637.1.91998 WP_001249637.1.92112 WP_001249637.1.92179 WP_001249637.1.92230 WP_001249637.1.9228 WP_001249637.1.9233 WP_001249637.1.92365 WP_001249637.1.92417 WP_001249637.1.92513 WP_001249637.1.92515 WP_001249637.1.92687 WP_001249637.1.92711 WP_001249637.1.92749 WP_001249637.1.92830 WP_001249637.1.92945 WP_001249637.1.92998 WP_001249637.1.9309 WP_001249637.1.93094 WP_001249637.1.93114 WP_001249637.1.9316 WP_001249637.1.93280 WP_001249637.1.93451 WP_001249637.1.93580 WP_001249637.1.93682 WP_001249637.1.93778 WP_001249637.1.93796 WP_001249637.1.93849 WP_001249637.1.93868 WP_001249637.1.93948 WP_001249637.1.93991 WP_001249637.1.94015 WP_001249637.1.94034 WP_001249637.1.94144 WP_001249637.1.94265 WP_001249637.1.94387 WP_001249637.1.94410 WP_001249637.1.94725 WP_001249637.1.94740 WP_001249637.1.94900 WP_001249637.1.95026 WP_001249637.1.95040 WP_001249637.1.95092 WP_001249637.1.95109 WP_001249637.1.95111 WP_001249637.1.95118 WP_001249637.1.95220 WP_001249637.1.95260 WP_001249637.1.95269 WP_001249637.1.95270 WP_001249637.1.9536 WP_001249637.1.95539 WP_001249637.1.95622 WP_001249637.1.95653 WP_001249637.1.95665 WP_001249637.1.95755 WP_001249637.1.95844 WP_001249637.1.95859 WP_001249637.1.95873 WP_001249637.1.95923 WP_001249637.1.9593 WP_001249637.1.96046 WP_001249637.1.962 WP_001249637.1.96323 WP_001249637.1.9645 WP_001249637.1.96556 WP_001249637.1.96598 WP_001249637.1.96696 WP_001249637.1.96747 WP_001249637.1.96942 WP_001249637.1.96998 WP_001249637.1.97032 WP_001249637.1.9714 WP_001249637.1.97163 WP_001249637.1.9733 WP_001249637.1.97520 WP_001249637.1.97709 WP_001249637.1.97710 WP_001249637.1.97780 WP_001249637.1.97844 WP_001249637.1.97893 WP_001249637.1.97920 WP_001249637.1.9794 WP_001249637.1.98004 WP_001249637.1.98007 WP_001249637.1.98068 WP_001249637.1.98150 WP_001249637.1.98224 WP_001249637.1.98272 WP_001249637.1.9832 WP_001249637.1.98354 WP_001249637.1.98523 WP_001249637.1.98561 WP_001249637.1.98691 WP_001249637.1.98692 WP_001249637.1.987 WP_001249637.1.98806 WP_001249637.1.98835 WP_001249637.1.98919 WP_001249637.1.98950 WP_001249637.1.98965 WP_001249637.1.98968 WP_001249637.1.98986 WP_001249637.1.98998 WP_001249637.1.99048 WP_001249637.1.99049 WP_001249637.1.99077 WP_001249637.1.99120 WP_001249637.1.99162 WP_001249637.1.99188 WP_001249637.1.99206 WP_001249637.1.99250 WP_001249637.1.99391 WP_001249637.1.99420 WP_001249637.1.99449 WP_001249637.1.99464 WP_001249637.1.9952 WP_001249637.1.99555 WP_001249637.1.99653 WP_001249637.1.99775 WP_001249637.1.99825 WP_001249637.1.99833 WP_001249637.1.99868 WP_001249637.1.99964 WP_001249637.1.9997 gi|523523380|ref|YP_008209459.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]