SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|525855994|ref|YP_008258615.1| from Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|525855994|ref|YP_008258615.1|
Domain Number 1 Region: 5-345
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 2.35e-60
Family ADP-ribosylglycohydrolase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|525855994|ref|YP_008258615.1|
Sequence length 346
Comment ADP-ribosylglycohydrolase [Salmonella enterica subsp. enterica serovar Cubana str. CFSAN002050]
Sequence
MHVDQNKILGCLVGAAAADAMGAATEVRTQQQIKDYFGGWVTTFQKPPADTFGRCNEAGM
CTDDFIQAKYIMDALLRHQRQVSDEAMREAFQQWLDYPYYANFTGPTTRAAMKAIFNDNR
ASLQGELEGEKQSVQIINKGNAEATNGAAMKIWPAAVLHPGDIDAAIDCALQICRFTHNN
VLAMSGAAAMAAATSEALRAQTNADSIIAAGIYGAQRGYLLAQEQGAMMVAGPSVARRIE
LAVDIGKRHRHWETAVVELADIIGSGLHVSEAVPAAFGLFACCPNSAVDAIISGVNIGND
TDTVATMVGAISGAFHGVEAFPADYLTTLDRMNHFDLAELARQIAG
Download sequence
Identical sequences A0A0H2WVK8 A0A0L3JKE1 A0A0N1QSP3 A0A100PTG3 A0A1C3A0H9 A0A1R2K2D2 A0A1S0Z922 A0A1X2RMH0 A0A1X2UKV1 A0A1X2Y055 A0A267SII7 A0A271CHC6 A0A271CNF6 A0A2D1XXK0 A0A2G1NKV9 A0A2I6ME41 A0A2I6N5L1 A0A2I6NWV6 A0A2J0S0M8 A0A2K2Z568 G5MQY0 G5QB03 G5R8C1 G5RNB0 G5S0H1 G5SJG1 M7REX6 S4IFB7 S5HGE1 V7IVX0
gi|452122156|ref|YP_007472404.1| gi|409247745|ref|YP_006888440.1| gi|207859255|ref|YP_002245906.1| gi|525855994|ref|YP_008258615.1| gi|537438760|ref|YP_008483137.1| ABEH02000008|CDS_179440-180480 ABEJ01000012|CDS_75190-76230 ABEW01000011|CDS_77861-78901 ABFF01000013|CDS_65250-64210 AM933172|CDS_4146095-4147135 CP000026|CDS_4055957-4056997 CP000886|CDS_4219304-4220344 CP001127|CDS_4154967-4156007 CP001144|CDS_4304871-4305911 FM200053|CDS_4051641-4052681 WP_000557882.1.100017 WP_000557882.1.100077 WP_000557882.1.100149 WP_000557882.1.100191 WP_000557882.1.1002 WP_000557882.1.100266 WP_000557882.1.100392 WP_000557882.1.100412 WP_000557882.1.100432 WP_000557882.1.100457 WP_000557882.1.100519 WP_000557882.1.100521 WP_000557882.1.100642 WP_000557882.1.10065 WP_000557882.1.100714 WP_000557882.1.100776 WP_000557882.1.10081 WP_000557882.1.100814 WP_000557882.1.100857 WP_000557882.1.100895 WP_000557882.1.101042 WP_000557882.1.101091 WP_000557882.1.101094 WP_000557882.1.101111 WP_000557882.1.101112 WP_000557882.1.101123 WP_000557882.1.101126 WP_000557882.1.101147 WP_000557882.1.101239 WP_000557882.1.101425 WP_000557882.1.101454 WP_000557882.1.101473 WP_000557882.1.101541 WP_000557882.1.101609 WP_000557882.1.101634 WP_000557882.1.101636 WP_000557882.1.101639 WP_000557882.1.10164 WP_000557882.1.101666 WP_000557882.1.101674 WP_000557882.1.10177 WP_000557882.1.101832 WP_000557882.1.101841 WP_000557882.1.101868 WP_000557882.1.101904 WP_000557882.1.10191 WP_000557882.1.101917 WP_000557882.1.101927 WP_000557882.1.101975 WP_000557882.1.102111 WP_000557882.1.10237 WP_000557882.1.10276 WP_000557882.1.10300 WP_000557882.1.10498 WP_000557882.1.10521 WP_000557882.1.10568 WP_000557882.1.106 WP_000557882.1.10631 WP_000557882.1.10711 WP_000557882.1.10755 WP_000557882.1.10868 WP_000557882.1.10898 WP_000557882.1.11041 WP_000557882.1.11119 WP_000557882.1.11213 WP_000557882.1.11216 WP_000557882.1.113 WP_000557882.1.1135 WP_000557882.1.11362 WP_000557882.1.11444 WP_000557882.1.11479 WP_000557882.1.1150 WP_000557882.1.11511 WP_000557882.1.11526 WP_000557882.1.11528 WP_000557882.1.1156 WP_000557882.1.11603 WP_000557882.1.1169 WP_000557882.1.1174 WP_000557882.1.11810 WP_000557882.1.11824 WP_000557882.1.11841 WP_000557882.1.11868 WP_000557882.1.11900 WP_000557882.1.11964 WP_000557882.1.11978 WP_000557882.1.12027 WP_000557882.1.12106 WP_000557882.1.12144 WP_000557882.1.1215 WP_000557882.1.12168 WP_000557882.1.12210 WP_000557882.1.12282 WP_000557882.1.12308 WP_000557882.1.12340 WP_000557882.1.12374 WP_000557882.1.1239 WP_000557882.1.12396 WP_000557882.1.1246 WP_000557882.1.12485 WP_000557882.1.1250 WP_000557882.1.12568 WP_000557882.1.12569 WP_000557882.1.12696 WP_000557882.1.12701 WP_000557882.1.12864 WP_000557882.1.12865 WP_000557882.1.12877 WP_000557882.1.13076 WP_000557882.1.13102 WP_000557882.1.13247 WP_000557882.1.13262 WP_000557882.1.13274 WP_000557882.1.13367 WP_000557882.1.1346 WP_000557882.1.13528 WP_000557882.1.13543 WP_000557882.1.13573 WP_000557882.1.13602 WP_000557882.1.13625 WP_000557882.1.13691 WP_000557882.1.13750 WP_000557882.1.13799 WP_000557882.1.13827 WP_000557882.1.13848 WP_000557882.1.13967 WP_000557882.1.14011 WP_000557882.1.14050 WP_000557882.1.14056 WP_000557882.1.1412 WP_000557882.1.14296 WP_000557882.1.1440 WP_000557882.1.146 WP_000557882.1.14708 WP_000557882.1.14793 WP_000557882.1.14819 WP_000557882.1.14876 WP_000557882.1.14884 WP_000557882.1.14913 WP_000557882.1.14917 WP_000557882.1.14927 WP_000557882.1.15011 WP_000557882.1.15054 WP_000557882.1.15059 WP_000557882.1.15067 WP_000557882.1.15214 WP_000557882.1.15276 WP_000557882.1.15318 WP_000557882.1.15585 WP_000557882.1.15627 WP_000557882.1.1568 WP_000557882.1.15775 WP_000557882.1.15777 WP_000557882.1.15795 WP_000557882.1.158 WP_000557882.1.15835 WP_000557882.1.15938 WP_000557882.1.16201 WP_000557882.1.16244 WP_000557882.1.16363 WP_000557882.1.16365 WP_000557882.1.16394 WP_000557882.1.16453 WP_000557882.1.16474 WP_000557882.1.16508 WP_000557882.1.16551 WP_000557882.1.16710 WP_000557882.1.16729 WP_000557882.1.16804 WP_000557882.1.16817 WP_000557882.1.16855 WP_000557882.1.1689 WP_000557882.1.16910 WP_000557882.1.16949 WP_000557882.1.16972 WP_000557882.1.16998 WP_000557882.1.17060 WP_000557882.1.17096 WP_000557882.1.17098 WP_000557882.1.17105 WP_000557882.1.17270 WP_000557882.1.1733 WP_000557882.1.1737 WP_000557882.1.17482 WP_000557882.1.17525 WP_000557882.1.1757 WP_000557882.1.17583 WP_000557882.1.17732 WP_000557882.1.17755 WP_000557882.1.17886 WP_000557882.1.17914 WP_000557882.1.18056 WP_000557882.1.18061 WP_000557882.1.18089 WP_000557882.1.18092 WP_000557882.1.18103 WP_000557882.1.18109 WP_000557882.1.18149 WP_000557882.1.1825 WP_000557882.1.18277 WP_000557882.1.18355 WP_000557882.1.18384 WP_000557882.1.18426 WP_000557882.1.18485 WP_000557882.1.18489 WP_000557882.1.18641 WP_000557882.1.18686 WP_000557882.1.18737 WP_000557882.1.18847 WP_000557882.1.18886 WP_000557882.1.18895 WP_000557882.1.1895 WP_000557882.1.19038 WP_000557882.1.19064 WP_000557882.1.19093 WP_000557882.1.19174 WP_000557882.1.19340 WP_000557882.1.19373 WP_000557882.1.1939 WP_000557882.1.19405 WP_000557882.1.19433 WP_000557882.1.1954 WP_000557882.1.1955 WP_000557882.1.19656 WP_000557882.1.1968 WP_000557882.1.19683 WP_000557882.1.19740 WP_000557882.1.19834 WP_000557882.1.19882 WP_000557882.1.19884 WP_000557882.1.19970 WP_000557882.1.19987 WP_000557882.1.20086 WP_000557882.1.20218 WP_000557882.1.2026 WP_000557882.1.20261 WP_000557882.1.20349 WP_000557882.1.2041 WP_000557882.1.20415 WP_000557882.1.20437 WP_000557882.1.20488 WP_000557882.1.20564 WP_000557882.1.20760 WP_000557882.1.20767 WP_000557882.1.20787 WP_000557882.1.20810 WP_000557882.1.20862 WP_000557882.1.20900 WP_000557882.1.2107 WP_000557882.1.21079 WP_000557882.1.21103 WP_000557882.1.2116 WP_000557882.1.21181 WP_000557882.1.21194 WP_000557882.1.21202 WP_000557882.1.21241 WP_000557882.1.21260 WP_000557882.1.2130 WP_000557882.1.21332 WP_000557882.1.21362 WP_000557882.1.2139 WP_000557882.1.2146 WP_000557882.1.21473 WP_000557882.1.21534 WP_000557882.1.21616 WP_000557882.1.21681 WP_000557882.1.21715 WP_000557882.1.21728 WP_000557882.1.21730 WP_000557882.1.21877 WP_000557882.1.21886 WP_000557882.1.21909 WP_000557882.1.21940 WP_000557882.1.21950 WP_000557882.1.22051 WP_000557882.1.22069 WP_000557882.1.22096 WP_000557882.1.22136 WP_000557882.1.22158 WP_000557882.1.22162 WP_000557882.1.22240 WP_000557882.1.22296 WP_000557882.1.22323 WP_000557882.1.22346 WP_000557882.1.22388 WP_000557882.1.22449 WP_000557882.1.22451 WP_000557882.1.22454 WP_000557882.1.22460 WP_000557882.1.22566 WP_000557882.1.22575 WP_000557882.1.22590 WP_000557882.1.22605 WP_000557882.1.22760 WP_000557882.1.2283 WP_000557882.1.22855 WP_000557882.1.22857 WP_000557882.1.22880 WP_000557882.1.22902 WP_000557882.1.22947 WP_000557882.1.22966 WP_000557882.1.23053 WP_000557882.1.23148 WP_000557882.1.23201 WP_000557882.1.2324 WP_000557882.1.23274 WP_000557882.1.23279 WP_000557882.1.23329 WP_000557882.1.23442 WP_000557882.1.23444 WP_000557882.1.235 WP_000557882.1.23529 WP_000557882.1.2358 WP_000557882.1.23631 WP_000557882.1.23639 WP_000557882.1.23646 WP_000557882.1.23746 WP_000557882.1.24145 WP_000557882.1.24214 WP_000557882.1.24250 WP_000557882.1.24297 WP_000557882.1.24303 WP_000557882.1.24361 WP_000557882.1.24394 WP_000557882.1.24408 WP_000557882.1.24409 WP_000557882.1.24412 WP_000557882.1.24450 WP_000557882.1.24476 WP_000557882.1.24494 WP_000557882.1.24521 WP_000557882.1.24673 WP_000557882.1.24689 WP_000557882.1.24727 WP_000557882.1.24803 WP_000557882.1.24901 WP_000557882.1.24944 WP_000557882.1.24995 WP_000557882.1.25130 WP_000557882.1.25159 WP_000557882.1.25175 WP_000557882.1.25297 WP_000557882.1.25354 WP_000557882.1.25397 WP_000557882.1.25421 WP_000557882.1.25596 WP_000557882.1.25618 WP_000557882.1.2568 WP_000557882.1.25708 WP_000557882.1.25709 WP_000557882.1.25780 WP_000557882.1.2581 WP_000557882.1.25846 WP_000557882.1.25928 WP_000557882.1.25951 WP_000557882.1.26083 WP_000557882.1.26122 WP_000557882.1.26194 WP_000557882.1.26213 WP_000557882.1.26512 WP_000557882.1.26532 WP_000557882.1.26563 WP_000557882.1.26587 WP_000557882.1.2667 WP_000557882.1.26687 WP_000557882.1.2672 WP_000557882.1.26750 WP_000557882.1.26758 WP_000557882.1.26794 WP_000557882.1.26833 WP_000557882.1.26882 WP_000557882.1.26936 WP_000557882.1.27051 WP_000557882.1.27055 WP_000557882.1.27072 WP_000557882.1.27122 WP_000557882.1.27169 WP_000557882.1.27272 WP_000557882.1.27314 WP_000557882.1.27383 WP_000557882.1.27452 WP_000557882.1.27522 WP_000557882.1.27547 WP_000557882.1.27632 WP_000557882.1.27638 WP_000557882.1.27655 WP_000557882.1.27658 WP_000557882.1.27755 WP_000557882.1.27798 WP_000557882.1.27800 WP_000557882.1.27833 WP_000557882.1.27969 WP_000557882.1.28037 WP_000557882.1.28056 WP_000557882.1.2806 WP_000557882.1.28116 WP_000557882.1.28139 WP_000557882.1.28174 WP_000557882.1.28200 WP_000557882.1.28225 WP_000557882.1.28232 WP_000557882.1.28233 WP_000557882.1.28303 WP_000557882.1.28462 WP_000557882.1.2853 WP_000557882.1.28570 WP_000557882.1.28620 WP_000557882.1.28773 WP_000557882.1.28830 WP_000557882.1.28921 WP_000557882.1.28948 WP_000557882.1.28963 WP_000557882.1.29168 WP_000557882.1.29218 WP_000557882.1.29274 WP_000557882.1.2932 WP_000557882.1.29349 WP_000557882.1.29379 WP_000557882.1.29422 WP_000557882.1.29436 WP_000557882.1.29576 WP_000557882.1.29711 WP_000557882.1.2984 WP_000557882.1.29845 WP_000557882.1.3005 WP_000557882.1.30059 WP_000557882.1.30165 WP_000557882.1.30195 WP_000557882.1.30210 WP_000557882.1.30213 WP_000557882.1.30225 WP_000557882.1.30238 WP_000557882.1.30278 WP_000557882.1.30356 WP_000557882.1.30386 WP_000557882.1.30492 WP_000557882.1.30548 WP_000557882.1.30555 WP_000557882.1.30589 WP_000557882.1.30627 WP_000557882.1.30635 WP_000557882.1.3066 WP_000557882.1.3067 WP_000557882.1.3068 WP_000557882.1.30752 WP_000557882.1.30802 WP_000557882.1.30819 WP_000557882.1.3089 WP_000557882.1.30934 WP_000557882.1.30968 WP_000557882.1.31001 WP_000557882.1.31042 WP_000557882.1.31069 WP_000557882.1.3114 WP_000557882.1.31167 WP_000557882.1.31171 WP_000557882.1.31262 WP_000557882.1.31272 WP_000557882.1.31335 WP_000557882.1.31435 WP_000557882.1.31546 WP_000557882.1.31585 WP_000557882.1.31665 WP_000557882.1.3167 WP_000557882.1.3185 WP_000557882.1.31895 WP_000557882.1.31901 WP_000557882.1.31983 WP_000557882.1.32006 WP_000557882.1.32038 WP_000557882.1.32054 WP_000557882.1.32109 WP_000557882.1.32116 WP_000557882.1.32204 WP_000557882.1.32252 WP_000557882.1.32274 WP_000557882.1.32275 WP_000557882.1.32309 WP_000557882.1.32357 WP_000557882.1.32459 WP_000557882.1.32491 WP_000557882.1.32519 WP_000557882.1.32643 WP_000557882.1.32668 WP_000557882.1.32832 WP_000557882.1.32881 WP_000557882.1.32899 WP_000557882.1.329 WP_000557882.1.32961 WP_000557882.1.32977 WP_000557882.1.3304 WP_000557882.1.3310 WP_000557882.1.33106 WP_000557882.1.33114 WP_000557882.1.33144 WP_000557882.1.33253 WP_000557882.1.33270 WP_000557882.1.33409 WP_000557882.1.33420 WP_000557882.1.33486 WP_000557882.1.33499 WP_000557882.1.33504 WP_000557882.1.3356 WP_000557882.1.33586 WP_000557882.1.3364 WP_000557882.1.33865 WP_000557882.1.33870 WP_000557882.1.3396 WP_000557882.1.33986 WP_000557882.1.34022 WP_000557882.1.34081 WP_000557882.1.34091 WP_000557882.1.34179 WP_000557882.1.34184 WP_000557882.1.34185 WP_000557882.1.34259 WP_000557882.1.34292 WP_000557882.1.34304 WP_000557882.1.3438 WP_000557882.1.34424 WP_000557882.1.34431 WP_000557882.1.3445 WP_000557882.1.34454 WP_000557882.1.34458 WP_000557882.1.34614 WP_000557882.1.34647 WP_000557882.1.34659 WP_000557882.1.34684 WP_000557882.1.34704 WP_000557882.1.34711 WP_000557882.1.34745 WP_000557882.1.34820 WP_000557882.1.34854 WP_000557882.1.34972 WP_000557882.1.35035 WP_000557882.1.35075 WP_000557882.1.35125 WP_000557882.1.35219 WP_000557882.1.35294 WP_000557882.1.35298 WP_000557882.1.35321 WP_000557882.1.35331 WP_000557882.1.35332 WP_000557882.1.35371 WP_000557882.1.35460 WP_000557882.1.35507 WP_000557882.1.35563 WP_000557882.1.35570 WP_000557882.1.35594 WP_000557882.1.35619 WP_000557882.1.35624 WP_000557882.1.3572 WP_000557882.1.35777 WP_000557882.1.35868 WP_000557882.1.35887 WP_000557882.1.35936 WP_000557882.1.35961 WP_000557882.1.35993 WP_000557882.1.36037 WP_000557882.1.36057 WP_000557882.1.36063 WP_000557882.1.3610 WP_000557882.1.36172 WP_000557882.1.36236 WP_000557882.1.36286 WP_000557882.1.36409 WP_000557882.1.36425 WP_000557882.1.36445 WP_000557882.1.36542 WP_000557882.1.36584 WP_000557882.1.36586 WP_000557882.1.36592 WP_000557882.1.36652 WP_000557882.1.36685 WP_000557882.1.36721 WP_000557882.1.36764 WP_000557882.1.36765 WP_000557882.1.36792 WP_000557882.1.36875 WP_000557882.1.3688 WP_000557882.1.36889 WP_000557882.1.37029 WP_000557882.1.37100 WP_000557882.1.37114 WP_000557882.1.37191 WP_000557882.1.3726 WP_000557882.1.37267 WP_000557882.1.37297 WP_000557882.1.37320 WP_000557882.1.37351 WP_000557882.1.37363 WP_000557882.1.37405 WP_000557882.1.37478 WP_000557882.1.3748 WP_000557882.1.37521 WP_000557882.1.3756 WP_000557882.1.37719 WP_000557882.1.3778 WP_000557882.1.37808 WP_000557882.1.37864 WP_000557882.1.3790 WP_000557882.1.38026 WP_000557882.1.38037 WP_000557882.1.38047 WP_000557882.1.38344 WP_000557882.1.38408 WP_000557882.1.38452 WP_000557882.1.38609 WP_000557882.1.38620 WP_000557882.1.38740 WP_000557882.1.38797 WP_000557882.1.38857 WP_000557882.1.38898 WP_000557882.1.39048 WP_000557882.1.39055 WP_000557882.1.39059 WP_000557882.1.39065 WP_000557882.1.39075 WP_000557882.1.39082 WP_000557882.1.39112 WP_000557882.1.39140 WP_000557882.1.39146 WP_000557882.1.39311 WP_000557882.1.39312 WP_000557882.1.39395 WP_000557882.1.39414 WP_000557882.1.39576 WP_000557882.1.39609 WP_000557882.1.39614 WP_000557882.1.39953 WP_000557882.1.40031 WP_000557882.1.40081 WP_000557882.1.40158 WP_000557882.1.40205 WP_000557882.1.40224 WP_000557882.1.40229 WP_000557882.1.40258 WP_000557882.1.40284 WP_000557882.1.40307 WP_000557882.1.40492 WP_000557882.1.40493 WP_000557882.1.40533 WP_000557882.1.40577 WP_000557882.1.40583 WP_000557882.1.40622 WP_000557882.1.40648 WP_000557882.1.40688 WP_000557882.1.40693 WP_000557882.1.40695 WP_000557882.1.40745 WP_000557882.1.40849 WP_000557882.1.4088 WP_000557882.1.40930 WP_000557882.1.40973 WP_000557882.1.41116 WP_000557882.1.41128 WP_000557882.1.41192 WP_000557882.1.41277 WP_000557882.1.41299 WP_000557882.1.4141 WP_000557882.1.41427 WP_000557882.1.41434 WP_000557882.1.41528 WP_000557882.1.41610 WP_000557882.1.41688 WP_000557882.1.41690 WP_000557882.1.41735 WP_000557882.1.41799 WP_000557882.1.41802 WP_000557882.1.41877 WP_000557882.1.41911 WP_000557882.1.41938 WP_000557882.1.41949 WP_000557882.1.41978 WP_000557882.1.41994 WP_000557882.1.42098 WP_000557882.1.42136 WP_000557882.1.422 WP_000557882.1.42238 WP_000557882.1.42248 WP_000557882.1.42263 WP_000557882.1.4229 WP_000557882.1.42322 WP_000557882.1.42356 WP_000557882.1.42372 WP_000557882.1.42392 WP_000557882.1.42404 WP_000557882.1.42595 WP_000557882.1.42605 WP_000557882.1.42666 WP_000557882.1.42675 WP_000557882.1.42683 WP_000557882.1.42734 WP_000557882.1.42892 WP_000557882.1.42923 WP_000557882.1.42932 WP_000557882.1.42978 WP_000557882.1.42981 WP_000557882.1.43089 WP_000557882.1.43126 WP_000557882.1.43160 WP_000557882.1.43201 WP_000557882.1.43258 WP_000557882.1.43276 WP_000557882.1.4332 WP_000557882.1.4344 WP_000557882.1.43441 WP_000557882.1.43476 WP_000557882.1.43528 WP_000557882.1.43654 WP_000557882.1.43685 WP_000557882.1.43711 WP_000557882.1.4373 WP_000557882.1.43954 WP_000557882.1.44010 WP_000557882.1.44063 WP_000557882.1.44144 WP_000557882.1.44187 WP_000557882.1.44191 WP_000557882.1.4422 WP_000557882.1.4423 WP_000557882.1.44337 WP_000557882.1.44339 WP_000557882.1.44380 WP_000557882.1.44397 WP_000557882.1.44443 WP_000557882.1.44474 WP_000557882.1.44593 WP_000557882.1.44606 WP_000557882.1.44633 WP_000557882.1.44678 WP_000557882.1.44687 WP_000557882.1.44702 WP_000557882.1.44831 WP_000557882.1.44833 WP_000557882.1.44887 WP_000557882.1.449 WP_000557882.1.44950 WP_000557882.1.44966 WP_000557882.1.44978 WP_000557882.1.44985 WP_000557882.1.44996 WP_000557882.1.44997 WP_000557882.1.4500 WP_000557882.1.45027 WP_000557882.1.45038 WP_000557882.1.4505 WP_000557882.1.45154 WP_000557882.1.45173 WP_000557882.1.45251 WP_000557882.1.45302 WP_000557882.1.4531 WP_000557882.1.45322 WP_000557882.1.4540 WP_000557882.1.45402 WP_000557882.1.45432 WP_000557882.1.45462 WP_000557882.1.45544 WP_000557882.1.45549 WP_000557882.1.45566 WP_000557882.1.45569 WP_000557882.1.45571 WP_000557882.1.45583 WP_000557882.1.45781 WP_000557882.1.45844 WP_000557882.1.45906 WP_000557882.1.45918 WP_000557882.1.4592 WP_000557882.1.46091 WP_000557882.1.46205 WP_000557882.1.46215 WP_000557882.1.46299 WP_000557882.1.46323 WP_000557882.1.46406 WP_000557882.1.46444 WP_000557882.1.46499 WP_000557882.1.46572 WP_000557882.1.46578 WP_000557882.1.4671 WP_000557882.1.46726 WP_000557882.1.4674 WP_000557882.1.46804 WP_000557882.1.4686 WP_000557882.1.46967 WP_000557882.1.46976 WP_000557882.1.47005 WP_000557882.1.47014 WP_000557882.1.47023 WP_000557882.1.47061 WP_000557882.1.47243 WP_000557882.1.47442 WP_000557882.1.47482 WP_000557882.1.47506 WP_000557882.1.47507 WP_000557882.1.47542 WP_000557882.1.47567 WP_000557882.1.47576 WP_000557882.1.4758 WP_000557882.1.47660 WP_000557882.1.4770 WP_000557882.1.4775 WP_000557882.1.47829 WP_000557882.1.47875 WP_000557882.1.47911 WP_000557882.1.4795 WP_000557882.1.47988 WP_000557882.1.48124 WP_000557882.1.48134 WP_000557882.1.48218 WP_000557882.1.48247 WP_000557882.1.48268 WP_000557882.1.4839 WP_000557882.1.48493 WP_000557882.1.48510 WP_000557882.1.48524 WP_000557882.1.48647 WP_000557882.1.48768 WP_000557882.1.48774 WP_000557882.1.48797 WP_000557882.1.48841 WP_000557882.1.48855 WP_000557882.1.48908 WP_000557882.1.49012 WP_000557882.1.49090 WP_000557882.1.49162 WP_000557882.1.49175 WP_000557882.1.49262 WP_000557882.1.49309 WP_000557882.1.49311 WP_000557882.1.49334 WP_000557882.1.49358 WP_000557882.1.49375 WP_000557882.1.49430 WP_000557882.1.49443 WP_000557882.1.49494 WP_000557882.1.49574 WP_000557882.1.49647 WP_000557882.1.49650 WP_000557882.1.49770 WP_000557882.1.49778 WP_000557882.1.49790 WP_000557882.1.49848 WP_000557882.1.50003 WP_000557882.1.50128 WP_000557882.1.50153 WP_000557882.1.50198 WP_000557882.1.50238 WP_000557882.1.50251 WP_000557882.1.50332 WP_000557882.1.50349 WP_000557882.1.50386 WP_000557882.1.50413 WP_000557882.1.50449 WP_000557882.1.50480 WP_000557882.1.50529 WP_000557882.1.5058 WP_000557882.1.50652 WP_000557882.1.50684 WP_000557882.1.50750 WP_000557882.1.50769 WP_000557882.1.50800 WP_000557882.1.50893 WP_000557882.1.50905 WP_000557882.1.50954 WP_000557882.1.50960 WP_000557882.1.51117 WP_000557882.1.51308 WP_000557882.1.51338 WP_000557882.1.51356 WP_000557882.1.51412 WP_000557882.1.51414 WP_000557882.1.51451 WP_000557882.1.51502 WP_000557882.1.51514 WP_000557882.1.51518 WP_000557882.1.51615 WP_000557882.1.51642 WP_000557882.1.51764 WP_000557882.1.51810 WP_000557882.1.5185 WP_000557882.1.51868 WP_000557882.1.51914 WP_000557882.1.51930 WP_000557882.1.51994 WP_000557882.1.520 WP_000557882.1.52047 WP_000557882.1.52101 WP_000557882.1.5211 WP_000557882.1.52156 WP_000557882.1.52255 WP_000557882.1.52301 WP_000557882.1.52321 WP_000557882.1.52456 WP_000557882.1.52527 WP_000557882.1.52528 WP_000557882.1.52582 WP_000557882.1.52586 WP_000557882.1.5273 WP_000557882.1.52744 WP_000557882.1.52824 WP_000557882.1.52833 WP_000557882.1.52858 WP_000557882.1.5301 WP_000557882.1.53100 WP_000557882.1.53107 WP_000557882.1.53119 WP_000557882.1.5313 WP_000557882.1.53158 WP_000557882.1.53179 WP_000557882.1.53198 WP_000557882.1.53234 WP_000557882.1.53274 WP_000557882.1.53362 WP_000557882.1.53385 WP_000557882.1.53534 WP_000557882.1.53567 WP_000557882.1.53664 WP_000557882.1.53675 WP_000557882.1.53778 WP_000557882.1.53781 WP_000557882.1.53896 WP_000557882.1.53961 WP_000557882.1.54068 WP_000557882.1.54283 WP_000557882.1.54333 WP_000557882.1.54340 WP_000557882.1.54366 WP_000557882.1.54469 WP_000557882.1.54522 WP_000557882.1.54558 WP_000557882.1.5456 WP_000557882.1.5459 WP_000557882.1.54615 WP_000557882.1.5462 WP_000557882.1.54814 WP_000557882.1.54833 WP_000557882.1.54845 WP_000557882.1.54877 WP_000557882.1.5493 WP_000557882.1.54936 WP_000557882.1.54984 WP_000557882.1.54992 WP_000557882.1.55073 WP_000557882.1.55178 WP_000557882.1.55200 WP_000557882.1.5525 WP_000557882.1.55361 WP_000557882.1.55461 WP_000557882.1.55545 WP_000557882.1.55557 WP_000557882.1.55559 WP_000557882.1.55640 WP_000557882.1.55680 WP_000557882.1.55706 WP_000557882.1.5572 WP_000557882.1.5577 WP_000557882.1.55853 WP_000557882.1.55948 WP_000557882.1.56026 WP_000557882.1.56059 WP_000557882.1.56069 WP_000557882.1.56070 WP_000557882.1.56152 WP_000557882.1.56235 WP_000557882.1.56263 WP_000557882.1.56354 WP_000557882.1.56374 WP_000557882.1.56413 WP_000557882.1.56420 WP_000557882.1.56512 WP_000557882.1.56615 WP_000557882.1.56642 WP_000557882.1.56647 WP_000557882.1.5668 WP_000557882.1.56791 WP_000557882.1.56851 WP_000557882.1.56861 WP_000557882.1.56898 WP_000557882.1.56905 WP_000557882.1.56942 WP_000557882.1.56950 WP_000557882.1.57000 WP_000557882.1.57026 WP_000557882.1.57039 WP_000557882.1.57056 WP_000557882.1.5711 WP_000557882.1.57125 WP_000557882.1.57143 WP_000557882.1.57244 WP_000557882.1.57246 WP_000557882.1.57296 WP_000557882.1.57362 WP_000557882.1.57495 WP_000557882.1.57559 WP_000557882.1.5761 WP_000557882.1.57631 WP_000557882.1.57778 WP_000557882.1.5781 WP_000557882.1.57893 WP_000557882.1.58090 WP_000557882.1.58251 WP_000557882.1.5828 WP_000557882.1.58290 WP_000557882.1.58334 WP_000557882.1.58357 WP_000557882.1.58443 WP_000557882.1.58467 WP_000557882.1.58486 WP_000557882.1.58489 WP_000557882.1.58564 WP_000557882.1.58633 WP_000557882.1.58675 WP_000557882.1.587 WP_000557882.1.58729 WP_000557882.1.58749 WP_000557882.1.58831 WP_000557882.1.58884 WP_000557882.1.58926 WP_000557882.1.59012 WP_000557882.1.59068 WP_000557882.1.59142 WP_000557882.1.59148 WP_000557882.1.59163 WP_000557882.1.59276 WP_000557882.1.59294 WP_000557882.1.59295 WP_000557882.1.59335 WP_000557882.1.59427 WP_000557882.1.59486 WP_000557882.1.59521 WP_000557882.1.59538 WP_000557882.1.59548 WP_000557882.1.59562 WP_000557882.1.59587 WP_000557882.1.59604 WP_000557882.1.59646 WP_000557882.1.59709 WP_000557882.1.59710 WP_000557882.1.59848 WP_000557882.1.60015 WP_000557882.1.60126 WP_000557882.1.60137 WP_000557882.1.60209 WP_000557882.1.60231 WP_000557882.1.60320 WP_000557882.1.60330 WP_000557882.1.60425 WP_000557882.1.60469 WP_000557882.1.60713 WP_000557882.1.608 WP_000557882.1.60809 WP_000557882.1.60851 WP_000557882.1.60857 WP_000557882.1.60866 WP_000557882.1.60897 WP_000557882.1.6090 WP_000557882.1.60926 WP_000557882.1.60988 WP_000557882.1.61045 WP_000557882.1.61146 WP_000557882.1.61184 WP_000557882.1.61200 WP_000557882.1.61309 WP_000557882.1.61356 WP_000557882.1.61381 WP_000557882.1.6143 WP_000557882.1.61501 WP_000557882.1.61594 WP_000557882.1.61595 WP_000557882.1.61671 WP_000557882.1.61694 WP_000557882.1.61737 WP_000557882.1.6190 WP_000557882.1.61908 WP_000557882.1.61922 WP_000557882.1.62063 WP_000557882.1.62076 WP_000557882.1.62108 WP_000557882.1.62142 WP_000557882.1.62158 WP_000557882.1.62195 WP_000557882.1.62201 WP_000557882.1.62210 WP_000557882.1.62245 WP_000557882.1.62271 WP_000557882.1.62339 WP_000557882.1.62344 WP_000557882.1.62412 WP_000557882.1.62648 WP_000557882.1.627 WP_000557882.1.62725 WP_000557882.1.62745 WP_000557882.1.62757 WP_000557882.1.6292 WP_000557882.1.62983 WP_000557882.1.62988 WP_000557882.1.63045 WP_000557882.1.63102 WP_000557882.1.63186 WP_000557882.1.63229 WP_000557882.1.63250 WP_000557882.1.63358 WP_000557882.1.63497 WP_000557882.1.63499 WP_000557882.1.63509 WP_000557882.1.63513 WP_000557882.1.63529 WP_000557882.1.63585 WP_000557882.1.63603 WP_000557882.1.6367 WP_000557882.1.6370 WP_000557882.1.63748 WP_000557882.1.63782 WP_000557882.1.63831 WP_000557882.1.63851 WP_000557882.1.63863 WP_000557882.1.63864 WP_000557882.1.64010 WP_000557882.1.64085 WP_000557882.1.64109 WP_000557882.1.64121 WP_000557882.1.64157 WP_000557882.1.64229 WP_000557882.1.64266 WP_000557882.1.64294 WP_000557882.1.64350 WP_000557882.1.6437 WP_000557882.1.64389 WP_000557882.1.64462 WP_000557882.1.64500 WP_000557882.1.64597 WP_000557882.1.64690 WP_000557882.1.64711 WP_000557882.1.64758 WP_000557882.1.64771 WP_000557882.1.64798 WP_000557882.1.64919 WP_000557882.1.64944 WP_000557882.1.64972 WP_000557882.1.65052 WP_000557882.1.65185 WP_000557882.1.6525 WP_000557882.1.65295 WP_000557882.1.65357 WP_000557882.1.65363 WP_000557882.1.65394 WP_000557882.1.65475 WP_000557882.1.6550 WP_000557882.1.65538 WP_000557882.1.65601 WP_000557882.1.6561 WP_000557882.1.65687 WP_000557882.1.65698 WP_000557882.1.6572 WP_000557882.1.65771 WP_000557882.1.65795 WP_000557882.1.65818 WP_000557882.1.65849 WP_000557882.1.65876 WP_000557882.1.65881 WP_000557882.1.65883 WP_000557882.1.65901 WP_000557882.1.6594 WP_000557882.1.65945 WP_000557882.1.6595 WP_000557882.1.65968 WP_000557882.1.66082 WP_000557882.1.66085 WP_000557882.1.66122 WP_000557882.1.66171 WP_000557882.1.66235 WP_000557882.1.66250 WP_000557882.1.66272 WP_000557882.1.66289 WP_000557882.1.66315 WP_000557882.1.66385 WP_000557882.1.66400 WP_000557882.1.66428 WP_000557882.1.66446 WP_000557882.1.66539 WP_000557882.1.66630 WP_000557882.1.66702 WP_000557882.1.66733 WP_000557882.1.66779 WP_000557882.1.66800 WP_000557882.1.66937 WP_000557882.1.66959 WP_000557882.1.67 WP_000557882.1.67075 WP_000557882.1.6710 WP_000557882.1.67173 WP_000557882.1.67175 WP_000557882.1.67228 WP_000557882.1.67279 WP_000557882.1.67405 WP_000557882.1.67424 WP_000557882.1.6760 WP_000557882.1.67603 WP_000557882.1.67637 WP_000557882.1.67731 WP_000557882.1.67772 WP_000557882.1.67803 WP_000557882.1.6782 WP_000557882.1.67825 WP_000557882.1.67827 WP_000557882.1.67905 WP_000557882.1.67924 WP_000557882.1.67932 WP_000557882.1.67970 WP_000557882.1.67988 WP_000557882.1.68075 WP_000557882.1.6809 WP_000557882.1.68115 WP_000557882.1.68140 WP_000557882.1.68159 WP_000557882.1.68167 WP_000557882.1.6833 WP_000557882.1.68478 WP_000557882.1.68629 WP_000557882.1.68652 WP_000557882.1.68677 WP_000557882.1.6882 WP_000557882.1.6883 WP_000557882.1.68893 WP_000557882.1.68895 WP_000557882.1.6905 WP_000557882.1.69058 WP_000557882.1.69080 WP_000557882.1.69086 WP_000557882.1.69131 WP_000557882.1.69139 WP_000557882.1.69236 WP_000557882.1.69273 WP_000557882.1.69357 WP_000557882.1.69385 WP_000557882.1.69433 WP_000557882.1.69485 WP_000557882.1.69575 WP_000557882.1.69592 WP_000557882.1.69597 WP_000557882.1.69616 WP_000557882.1.69767 WP_000557882.1.69785 WP_000557882.1.69808 WP_000557882.1.69817 WP_000557882.1.69839 WP_000557882.1.69848 WP_000557882.1.69965 WP_000557882.1.69975 WP_000557882.1.70087 WP_000557882.1.70088 WP_000557882.1.7016 WP_000557882.1.70183 WP_000557882.1.70272 WP_000557882.1.70281 WP_000557882.1.70303 WP_000557882.1.70355 WP_000557882.1.7044 WP_000557882.1.70440 WP_000557882.1.70531 WP_000557882.1.7055 WP_000557882.1.70596 WP_000557882.1.7060 WP_000557882.1.70662 WP_000557882.1.70678 WP_000557882.1.70685 WP_000557882.1.70712 WP_000557882.1.70785 WP_000557882.1.70837 WP_000557882.1.70914 WP_000557882.1.70929 WP_000557882.1.7093 WP_000557882.1.70969 WP_000557882.1.70977 WP_000557882.1.70985 WP_000557882.1.70986 WP_000557882.1.71088 WP_000557882.1.71150 WP_000557882.1.71172 WP_000557882.1.71184 WP_000557882.1.71201 WP_000557882.1.71248 WP_000557882.1.71305 WP_000557882.1.7134 WP_000557882.1.7142 WP_000557882.1.71450 WP_000557882.1.71583 WP_000557882.1.71600 WP_000557882.1.71626 WP_000557882.1.71649 WP_000557882.1.71656 WP_000557882.1.71667 WP_000557882.1.71746 WP_000557882.1.71848 WP_000557882.1.71941 WP_000557882.1.71979 WP_000557882.1.71984 WP_000557882.1.720 WP_000557882.1.72100 WP_000557882.1.72121 WP_000557882.1.72182 WP_000557882.1.72190 WP_000557882.1.72221 WP_000557882.1.72254 WP_000557882.1.72277 WP_000557882.1.72300 WP_000557882.1.72325 WP_000557882.1.72339 WP_000557882.1.72382 WP_000557882.1.72438 WP_000557882.1.72470 WP_000557882.1.72532 WP_000557882.1.72602 WP_000557882.1.72625 WP_000557882.1.72642 WP_000557882.1.72716 WP_000557882.1.72718 WP_000557882.1.72797 WP_000557882.1.72827 WP_000557882.1.72850 WP_000557882.1.72865 WP_000557882.1.72892 WP_000557882.1.72894 WP_000557882.1.72946 WP_000557882.1.7295 WP_000557882.1.73068 WP_000557882.1.73102 WP_000557882.1.7316 WP_000557882.1.7341 WP_000557882.1.73708 WP_000557882.1.73764 WP_000557882.1.7386 WP_000557882.1.73945 WP_000557882.1.73958 WP_000557882.1.73965 WP_000557882.1.74040 WP_000557882.1.7405 WP_000557882.1.74117 WP_000557882.1.74174 WP_000557882.1.74228 WP_000557882.1.74248 WP_000557882.1.74300 WP_000557882.1.74418 WP_000557882.1.74428 WP_000557882.1.74469 WP_000557882.1.74570 WP_000557882.1.74578 WP_000557882.1.74632 WP_000557882.1.74661 WP_000557882.1.74741 WP_000557882.1.74757 WP_000557882.1.74806 WP_000557882.1.74876 WP_000557882.1.74884 WP_000557882.1.74972 WP_000557882.1.74992 WP_000557882.1.75009 WP_000557882.1.75056 WP_000557882.1.75058 WP_000557882.1.75114 WP_000557882.1.75134 WP_000557882.1.75148 WP_000557882.1.75159 WP_000557882.1.75168 WP_000557882.1.7531 WP_000557882.1.75371 WP_000557882.1.75400 WP_000557882.1.75450 WP_000557882.1.7558 WP_000557882.1.75607 WP_000557882.1.75609 WP_000557882.1.75664 WP_000557882.1.75716 WP_000557882.1.75751 WP_000557882.1.75794 WP_000557882.1.75810 WP_000557882.1.75863 WP_000557882.1.75902 WP_000557882.1.76102 WP_000557882.1.76108 WP_000557882.1.76115 WP_000557882.1.76137 WP_000557882.1.76156 WP_000557882.1.76170 WP_000557882.1.76186 WP_000557882.1.7629 WP_000557882.1.76301 WP_000557882.1.76345 WP_000557882.1.76346 WP_000557882.1.76451 WP_000557882.1.76495 WP_000557882.1.76548 WP_000557882.1.7655 WP_000557882.1.7657 WP_000557882.1.76576 WP_000557882.1.76611 WP_000557882.1.76776 WP_000557882.1.76913 WP_000557882.1.76968 WP_000557882.1.77033 WP_000557882.1.77067 WP_000557882.1.77271 WP_000557882.1.77306 WP_000557882.1.77356 WP_000557882.1.77390 WP_000557882.1.77475 WP_000557882.1.77496 WP_000557882.1.77596 WP_000557882.1.77761 WP_000557882.1.7784 WP_000557882.1.7792 WP_000557882.1.7793 WP_000557882.1.77951 WP_000557882.1.77983 WP_000557882.1.77989 WP_000557882.1.78016 WP_000557882.1.7802 WP_000557882.1.78051 WP_000557882.1.78168 WP_000557882.1.78170 WP_000557882.1.78180 WP_000557882.1.78245 WP_000557882.1.78301 WP_000557882.1.78339 WP_000557882.1.78352 WP_000557882.1.78366 WP_000557882.1.78443 WP_000557882.1.78501 WP_000557882.1.78603 WP_000557882.1.78632 WP_000557882.1.78697 WP_000557882.1.78734 WP_000557882.1.78738 WP_000557882.1.7877 WP_000557882.1.78771 WP_000557882.1.78789 WP_000557882.1.78815 WP_000557882.1.78877 WP_000557882.1.78896 WP_000557882.1.78913 WP_000557882.1.7893 WP_000557882.1.78951 WP_000557882.1.78959 WP_000557882.1.79011 WP_000557882.1.79032 WP_000557882.1.79099 WP_000557882.1.79189 WP_000557882.1.79289 WP_000557882.1.79466 WP_000557882.1.79468 WP_000557882.1.79531 WP_000557882.1.79580 WP_000557882.1.79586 WP_000557882.1.79635 WP_000557882.1.79645 WP_000557882.1.79757 WP_000557882.1.79778 WP_000557882.1.7982 WP_000557882.1.7991 WP_000557882.1.79910 WP_000557882.1.79934 WP_000557882.1.79966 WP_000557882.1.79977 WP_000557882.1.80045 WP_000557882.1.80149 WP_000557882.1.8024 WP_000557882.1.80249 WP_000557882.1.80254 WP_000557882.1.80293 WP_000557882.1.80307 WP_000557882.1.80333 WP_000557882.1.80380 WP_000557882.1.80496 WP_000557882.1.80609 WP_000557882.1.80651 WP_000557882.1.80667 WP_000557882.1.80674 WP_000557882.1.80707 WP_000557882.1.80750 WP_000557882.1.80760 WP_000557882.1.80803 WP_000557882.1.80827 WP_000557882.1.80840 WP_000557882.1.80876 WP_000557882.1.80959 WP_000557882.1.80973 WP_000557882.1.81041 WP_000557882.1.8106 WP_000557882.1.81062 WP_000557882.1.81084 WP_000557882.1.81109 WP_000557882.1.81110 WP_000557882.1.81118 WP_000557882.1.81197 WP_000557882.1.81225 WP_000557882.1.8130 WP_000557882.1.81321 WP_000557882.1.8134 WP_000557882.1.81388 WP_000557882.1.81455 WP_000557882.1.81504 WP_000557882.1.81568 WP_000557882.1.81668 WP_000557882.1.81727 WP_000557882.1.81768 WP_000557882.1.81798 WP_000557882.1.81977 WP_000557882.1.81995 WP_000557882.1.82141 WP_000557882.1.82144 WP_000557882.1.82149 WP_000557882.1.82269 WP_000557882.1.82347 WP_000557882.1.82352 WP_000557882.1.82401 WP_000557882.1.82420 WP_000557882.1.82434 WP_000557882.1.8247 WP_000557882.1.82474 WP_000557882.1.82530 WP_000557882.1.82562 WP_000557882.1.82637 WP_000557882.1.82692 WP_000557882.1.82886 WP_000557882.1.82899 WP_000557882.1.82937 WP_000557882.1.82946 WP_000557882.1.83005 WP_000557882.1.83006 WP_000557882.1.83119 WP_000557882.1.83204 WP_000557882.1.83247 WP_000557882.1.83280 WP_000557882.1.83331 WP_000557882.1.83354 WP_000557882.1.83356 WP_000557882.1.83360 WP_000557882.1.83378 WP_000557882.1.83382 WP_000557882.1.83388 WP_000557882.1.83510 WP_000557882.1.83558 WP_000557882.1.83572 WP_000557882.1.83806 WP_000557882.1.83897 WP_000557882.1.83960 WP_000557882.1.84000 WP_000557882.1.84011 WP_000557882.1.84075 WP_000557882.1.84083 WP_000557882.1.84086 WP_000557882.1.84106 WP_000557882.1.84115 WP_000557882.1.84154 WP_000557882.1.84168 WP_000557882.1.84198 WP_000557882.1.84229 WP_000557882.1.8425 WP_000557882.1.84300 WP_000557882.1.84325 WP_000557882.1.84403 WP_000557882.1.84461 WP_000557882.1.84515 WP_000557882.1.84523 WP_000557882.1.84551 WP_000557882.1.84572 WP_000557882.1.84598 WP_000557882.1.84683 WP_000557882.1.84721 WP_000557882.1.84745 WP_000557882.1.84814 WP_000557882.1.84872 WP_000557882.1.84876 WP_000557882.1.84879 WP_000557882.1.849 WP_000557882.1.84983 WP_000557882.1.850 WP_000557882.1.85031 WP_000557882.1.8526 WP_000557882.1.85271 WP_000557882.1.85301 WP_000557882.1.85654 WP_000557882.1.85675 WP_000557882.1.85759 WP_000557882.1.85784 WP_000557882.1.85854 WP_000557882.1.8591 WP_000557882.1.85982 WP_000557882.1.86007 WP_000557882.1.86092 WP_000557882.1.86126 WP_000557882.1.86138 WP_000557882.1.86157 WP_000557882.1.86159 WP_000557882.1.8616 WP_000557882.1.86240 WP_000557882.1.86335 WP_000557882.1.86347 WP_000557882.1.86380 WP_000557882.1.86466 WP_000557882.1.8647 WP_000557882.1.86514 WP_000557882.1.86601 WP_000557882.1.86610 WP_000557882.1.86658 WP_000557882.1.86915 WP_000557882.1.86921 WP_000557882.1.87038 WP_000557882.1.87143 WP_000557882.1.87187 WP_000557882.1.87220 WP_000557882.1.87265 WP_000557882.1.87276 WP_000557882.1.87283 WP_000557882.1.87376 WP_000557882.1.87484 WP_000557882.1.87500 WP_000557882.1.87583 WP_000557882.1.87626 WP_000557882.1.87651 WP_000557882.1.87712 WP_000557882.1.87760 WP_000557882.1.87813 WP_000557882.1.87891 WP_000557882.1.87936 WP_000557882.1.8800 WP_000557882.1.88052 WP_000557882.1.88136 WP_000557882.1.88174 WP_000557882.1.88185 WP_000557882.1.88222 WP_000557882.1.88275 WP_000557882.1.88356 WP_000557882.1.88423 WP_000557882.1.88483 WP_000557882.1.88508 WP_000557882.1.88597 WP_000557882.1.88651 WP_000557882.1.88675 WP_000557882.1.88731 WP_000557882.1.88776 WP_000557882.1.88817 WP_000557882.1.88966 WP_000557882.1.88968 WP_000557882.1.88982 WP_000557882.1.88995 WP_000557882.1.89054 WP_000557882.1.89120 WP_000557882.1.89177 WP_000557882.1.89188 WP_000557882.1.89215 WP_000557882.1.89221 WP_000557882.1.89311 WP_000557882.1.89355 WP_000557882.1.89362 WP_000557882.1.89408 WP_000557882.1.89425 WP_000557882.1.89452 WP_000557882.1.8958 WP_000557882.1.89606 WP_000557882.1.8961 WP_000557882.1.89634 WP_000557882.1.89680 WP_000557882.1.89764 WP_000557882.1.89832 WP_000557882.1.89914 WP_000557882.1.89965 WP_000557882.1.9003 WP_000557882.1.90033 WP_000557882.1.90293 WP_000557882.1.90421 WP_000557882.1.90521 WP_000557882.1.90522 WP_000557882.1.90540 WP_000557882.1.90563 WP_000557882.1.90566 WP_000557882.1.90748 WP_000557882.1.90759 WP_000557882.1.90859 WP_000557882.1.90959 WP_000557882.1.90973 WP_000557882.1.90983 WP_000557882.1.90984 WP_000557882.1.90991 WP_000557882.1.91023 WP_000557882.1.91215 WP_000557882.1.91282 WP_000557882.1.91312 WP_000557882.1.91331 WP_000557882.1.91334 WP_000557882.1.9137 WP_000557882.1.91372 WP_000557882.1.91381 WP_000557882.1.91405 WP_000557882.1.91424 WP_000557882.1.91459 WP_000557882.1.91473 WP_000557882.1.91474 WP_000557882.1.91493 WP_000557882.1.91580 WP_000557882.1.91625 WP_000557882.1.9166 WP_000557882.1.91702 WP_000557882.1.91742 WP_000557882.1.91772 WP_000557882.1.91776 WP_000557882.1.91795 WP_000557882.1.91880 WP_000557882.1.91898 WP_000557882.1.91904 WP_000557882.1.91914 WP_000557882.1.91974 WP_000557882.1.91984 WP_000557882.1.92039 WP_000557882.1.92068 WP_000557882.1.92082 WP_000557882.1.92129 WP_000557882.1.92149 WP_000557882.1.92213 WP_000557882.1.9222 WP_000557882.1.92270 WP_000557882.1.92399 WP_000557882.1.92411 WP_000557882.1.92452 WP_000557882.1.92529 WP_000557882.1.9253 WP_000557882.1.92557 WP_000557882.1.92575 WP_000557882.1.92628 WP_000557882.1.92646 WP_000557882.1.92659 WP_000557882.1.92754 WP_000557882.1.92786 WP_000557882.1.92806 WP_000557882.1.92836 WP_000557882.1.92842 WP_000557882.1.92843 WP_000557882.1.92879 WP_000557882.1.92890 WP_000557882.1.92926 WP_000557882.1.92929 WP_000557882.1.92936 WP_000557882.1.92947 WP_000557882.1.93076 WP_000557882.1.93118 WP_000557882.1.93215 WP_000557882.1.93350 WP_000557882.1.93410 WP_000557882.1.93524 WP_000557882.1.93577 WP_000557882.1.93671 WP_000557882.1.93767 WP_000557882.1.9380 WP_000557882.1.93809 WP_000557882.1.94071 WP_000557882.1.94352 WP_000557882.1.9440 WP_000557882.1.94473 WP_000557882.1.94557 WP_000557882.1.94588 WP_000557882.1.94598 WP_000557882.1.94649 WP_000557882.1.94670 WP_000557882.1.94835 WP_000557882.1.94862 WP_000557882.1.94971 WP_000557882.1.94983 WP_000557882.1.94986 WP_000557882.1.94987 WP_000557882.1.95133 WP_000557882.1.95136 WP_000557882.1.95152 WP_000557882.1.9527 WP_000557882.1.95320 WP_000557882.1.95404 WP_000557882.1.95434 WP_000557882.1.95447 WP_000557882.1.95465 WP_000557882.1.95558 WP_000557882.1.95656 WP_000557882.1.95701 WP_000557882.1.9574 WP_000557882.1.95757 WP_000557882.1.95803 WP_000557882.1.95826 WP_000557882.1.9586 WP_000557882.1.95866 WP_000557882.1.95963 WP_000557882.1.96045 WP_000557882.1.96107 WP_000557882.1.9624 WP_000557882.1.96340 WP_000557882.1.96348 WP_000557882.1.96349 WP_000557882.1.96380 WP_000557882.1.96404 WP_000557882.1.96429 WP_000557882.1.96490 WP_000557882.1.96521 WP_000557882.1.96533 WP_000557882.1.96584 WP_000557882.1.96588 WP_000557882.1.96662 WP_000557882.1.96731 WP_000557882.1.96735 WP_000557882.1.96761 WP_000557882.1.96890 WP_000557882.1.96993 WP_000557882.1.97005 WP_000557882.1.97043 WP_000557882.1.97089 WP_000557882.1.97103 WP_000557882.1.97109 WP_000557882.1.97322 WP_000557882.1.97328 WP_000557882.1.97368 WP_000557882.1.97386 WP_000557882.1.97413 WP_000557882.1.97496 WP_000557882.1.97534 WP_000557882.1.97547 WP_000557882.1.97626 WP_000557882.1.97648 WP_000557882.1.97656 WP_000557882.1.97704 WP_000557882.1.9774 WP_000557882.1.9793 WP_000557882.1.97981 WP_000557882.1.97991 WP_000557882.1.98107 WP_000557882.1.9811 WP_000557882.1.98119 WP_000557882.1.98201 WP_000557882.1.98236 WP_000557882.1.98338 WP_000557882.1.98392 WP_000557882.1.98403 WP_000557882.1.98440 WP_000557882.1.98472 WP_000557882.1.98551 WP_000557882.1.98570 WP_000557882.1.98634 WP_000557882.1.98726 WP_000557882.1.98751 WP_000557882.1.9887 WP_000557882.1.98931 WP_000557882.1.98947 WP_000557882.1.9899 WP_000557882.1.99040 WP_000557882.1.99057 WP_000557882.1.99073 WP_000557882.1.99097 WP_000557882.1.99164 WP_000557882.1.99197 WP_000557882.1.99198 WP_000557882.1.99215 WP_000557882.1.99339 WP_000557882.1.99370 WP_000557882.1.99456 WP_000557882.1.99490 WP_000557882.1.99493 WP_000557882.1.99531 WP_000557882.1.99577 WP_000557882.1.99613 WP_000557882.1.99630 WP_000557882.1.99637 WP_000557882.1.99924 WP_000557882.1.99961 gi|194734227|ref|YP_002116990.1| gi|197364841|ref|YP_002144478.1| 272994.SPAB_05040 295319.SPA3910 439843.SeSA_A4284 439851.SeD_A4465 550537.SEN3857 554290.SSPA3638 gi|56415912|ref|YP_152987.1| gi|378957193|ref|YP_005214680.1| gi|529221303|ref|YP_008382796.1| gi|161617199|ref|YP_001591164.1| gi|198242276|ref|YP_002217993.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]