SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269792641|ref|YP_003317545.1| from Thermanaerovibrio acidaminovorans DSM 6589

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269792641|ref|YP_003317545.1|
Domain Number 1 Region: 258-549
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 2.35e-75
Family DNA repair protein MutS, domain III 0.00000357
Further Details:      
 
Domain Number 2 Region: 551-785
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.73e-58
Family ABC transporter ATPase domain-like 0.000000903
Further Details:      
 
Domain Number 3 Region: 4-113
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.45e-37
Family DNA repair protein MutS, domain I 0.0000182
Further Details:      
 
Domain Number 4 Region: 124-269
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 8.24e-23
Family DNA repair protein MutS, domain II 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269792641|ref|YP_003317545.1|
Sequence length 851
Comment DNA mismatch repair protein MutS [Thermanaerovibrio acidaminovorans DSM 6589]
Sequence
MLPKGVKVTPMLEQYLHWKERYPDYLLFFRMGDFYELFFDDAKEASALLDIALTARDPER
AIPMAGVPYHAVEQYLSRLVELGKKVAICEQVSEPDGRTLVQRRVVRLVTPGTFVPSEGG
GDVHLVACVPRGEAWDLAVLSLSTGLFEAGTVPSGEVQGVLSSYFPTEVLLPKGKVPEDF
PWRWVEREVDLFSPRGAHGLLLKRFGLSTLEGLGFHPEDHALGAAGAVLRYAEETQFREL
SHLRPLRRISTGRGLMLDLTSQRNLDLVEPKGASLLGVLNFCKTPLGRRVLREWILHPLN
DPEEINLRLDGVEFFVKDRDGARALGEALSSVGDVERALSRLHLGTGGPKDAALCRDFLS
ALPRVEELTRRTPKAWHLDLSPRVLALGETLAKAIEDRPPRDVSDGGVIRGGFDPELDEL
RSFLGGHEGWLSSFEERERDRTGIRGLKVRYNKVFGYYIEVSRSNADRVPEDYERRQTLV
NAERFVTPELKEFEAKMARASEAVMSRERAVWERVLAELLSLTGELQRLARRVGELDCLF
SLGEAAFQRGYVRPQVDLGDELVIRDGRHPVVEVAMAPEPFTPNHMHLDSGSRRMILLTG
PNMAGKSTYLRMGALLVIMAQMGSFVPASHARVGCFNRIYTRIGARDDLARGQSTFMVEM
VETAQILNGLTGRSLVILDEIGRGTSTDDGMSIAWAVMEYLHERSDLAPKVLFATHYHEL
TSLAERLPGVSNWSVAVKETPRGVVFLHHVVPRPADRSYGVEVAKLAGLPEAVLRRSREL
LELFEGRRRRDVEGAAGKGMVRQTSLFDPGVDGILEELAACDPDNMTPLQCMERIYDLHK
RAVEILRGGRA
Download sequence
Identical sequences D1B5H2
525903.Taci_1031 gi|269792641|ref|YP_003317545.1| YP_003317545.1.71145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]