SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269792920|ref|YP_003317824.1| from Thermanaerovibrio acidaminovorans DSM 6589

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269792920|ref|YP_003317824.1|
Domain Number 1 Region: 173-360
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.48e-62
Family Methylesterase CheB, C-terminal domain 0.0000102
Further Details:      
 
Domain Number 2 Region: 6-113
Classification Level Classification E-value
Superfamily CheY-like 5.69e-30
Family CheY-related 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|269792920|ref|YP_003317824.1|
Sequence length 364
Comment response regulator receiver modulated CheB methylesterase [Thermanaerovibrio acidaminovorans DSM 6589]
Sequence
MTTSRKIRVMVVDDSAFMRKVIGDILSSDGRFEVVARVRDGEEALQKLQEASPDVITLDV
EMPRKNGLEALKEIMERRPTPVVMVSSLTREGAEVTLQALSLGAVDFVTKPSGTISLDMN
KVEEELKQKVWVASTVDRSRLGLRRFPPERRPQPPVSQPSAPAAATAPRRRPQRVDLLLI
ASSTGGPRALQEVIPAIRKDFPCPVLVVQHMPRGFTASFAERLDDASQLKVVEGYDGLKP
QRGMAVIAPGGYHMVVDRSGADLVCRLSDAPPVRSVKPAADMLFMSVADVVGGSVVAAVL
TGMGRDGADGALALHRKGGIILAESPETCVVYGMPRAVVEAGIADEVIPLYEMPEAFHRW
TVGP
Download sequence
Identical sequences D1B6A1
525903.Taci_1311 gi|269792920|ref|YP_003317824.1| YP_003317824.1.71145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]