SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|269958815|ref|YP_003328603.1| from Anaplasma centrale str. Israel

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|269958815|ref|YP_003328603.1|
Domain Number 1 Region: 532-1032
Classification Level Classification E-value
Superfamily ALDH-like 3.93e-128
Family ALDH-like 0.000000446
Further Details:      
 
Domain Number 2 Region: 179-521
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.88e-103
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000214
Further Details:      
 
Domain Number 3 Region: 9-177
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 3.53e-56
Family N-terminal domain of bifunctional PutA protein 0.000046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|269958815|ref|YP_003328603.1|
Sequence length 1048
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Anaplasma centrale str. Israel]
Sequence
MMISSLQSPNELRKRMQGLYNADEKSYTRYLAERTEVSQESKVRIYSLAKQIIERVRASK
SATMIDAFMQQYGLSTEEGLALMCLAESLLRIPDDCTIDDMIRDKIARTTWNKHIGRSAS
IFVNVSTLALSIGAHMLREVDDSRWYGILGNLLKDMGEPVIRKTALQAIQVLGKHYVCGR
TIEEAIAKSNENGSLCSFDVLGEAAQTRADADRYFASYMNVLETLGADPKAGAELESRHG
ISVKLSSLHPRYEFGQADYVLNDISSKLLELCQVAKKHNVRLTIDAEEARRLELSLMILD
KVFSDSSLNGWEGLGFVIQAYQKRALAALDFVEDVAIRANRKMVLRLVKGAYWDYEIRNA
QEMGLDGYPVFTRRAYTDVSYLACVQRVLSKPGTFYPCFATHNAYTLSFVLEMADKDHPG
FEFQRLHGMAQGLYDYVTKEIAPNVRCRVYAPIGQHKELLPYLIRRLIENGANVSFVNMI
NDADIPAESLCADPLEKAKSFEYMPHPSIPLPSEMFPDGRINSTGVNTSDSLSMLALSEE
VSAFDSTSWKAYPIIHGQDIEGGELYEVFSPASLSTKVGEVLFATAEHALQSVDAARSSF
HRWSNTPVGERADILEHAADLLEKEGRGKFFSLLIREGGKVIPDAVAEIREAVDFLRYYA
RLARDQLTDPIKLPGPAGEENYLYFESRGTFVCISPWNFPLAIFLGPIAAALVTGNTVIA
KPAEQTSLVAYEAVKLLYEAGVPTDVLHFLPGRGEVLGNALLSSPKIAGVAFTGSTETAN
IINQVIAGRSHDIIPLIAETGGINAMIVDSSALPEQVVGDVITSAFKSAGQRCSALRALF
LQDEIADGVIELLLGAVAELRLGNPMSLSTDIGPVIDQQSLDMLNAYVEEMQKKKIKLLC
KADIGYLHGGEEGYFFPPHIFEIESMSQLSREVFGPVLHVIRYKKPDLLNMLDDINSTGY
GLTFSIQSRIQSSIDDITDRIGAGNVYVNRHQIGAVPGVQPFGGRGLSGTGPKAGGPYYL
HRFLTEKAVTVNAAALGGSVSLVCLEDE
Download sequence
Identical sequences D1AUR1
574556.ACIS_00730 WP_012880745.1.29657 gi|269958815|ref|YP_003328603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]