SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|281411548|ref|YP_003345627.1| from Thermotoga naphthophila RKU-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|281411548|ref|YP_003345627.1|
Domain Number 1 Region: 199-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.12e-66
Family B3/B4 domain of PheRS, PheT 0.00000736
Further Details:      
 
Domain Number 2 Region: 463-681
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.63e-50
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00011
Further Details:      
 
Domain Number 3 Region: 44-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.57e-35
Family Myf domain 0.0039
Further Details:      
 
Domain Number 4 Region: 689-787
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.76e-29
Family Anticodon-binding domain of PheRS 0.00065
Further Details:      
 
Domain Number 5 Region: 401-471
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000687
Family Domains B1 and B5 of PheRS-beta, PheT 0.0021
Further Details:      
 
Weak hits

Sequence:  gi|281411548|ref|YP_003345627.1|
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0667
Family KorB DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|281411548|ref|YP_003345627.1|
Sequence length 788
Comment phenylalanyl-tRNA synthetase, beta subunit [Thermotoga naphthophila RKU-10]
Sequence
MRVPESWLREFVDLDWDIEQIAERLTFSGTSVEDILRPFNVSGEIITARVIERFDHPASE
KLIVCRVDTGKRIYTVVTADKTVNEGDYVILALEGATLNNGFKIEPREFKGVISEGMLCS
LEELGLEEKSDRVYRFPEPVELGVNVVEKYGLNERVLDIEITPNRPDCLSIIGVARELSA
LSGRPLKKPQPIVSFVDEDVQFDVKIEDVEGCPRYSARIMKGVTVKDSPLWMKARLVAAG
VRSLNNVVDATNYVMIELGHPVHAFDLNRLKNKRIVVKSAKGGERVLLLDEKEYELKGGE
VLITDGENVLALGGIMGGMESGVYDDTRDLVLEVAYFDPVRIRKAAKALGIDSESSYRFE
RGVDPNDVELVSLRLAELIQKLAGGYVLRKFWDVYPRKIEPKKVMLRKARIEKILGTKVE
KPGDILRRLEFQVEDRGDSYEVLVPTFRPDVEREIDLIEEIGRIYGYEKVESKVISVPAI
NRGWSEKQLFRREISQFMKGMGFDEVVTFSFVDSLKVKKWPLVDREPIALSNPIASDMDV
MRTSQFYSLIQVLAENFKRQNRDLKLFEIGKIYFKENGNFREIETLSAMSCGLENPGDYT
DKRSVSFYTIKGVLDELFFRLGVNVVYRAVEIPGLFPTRSARIYVENREIGFIGMVDPKL
LDEYDVKEDTYFFEIDMELLRKYASKRPAYRPTPRFPAVRRDISFLLPKGFESVKIIELF
KKSGGDLVEEVGVFDIYEGKGIPENMVSVTFYVVFRHSERTLTDEEVNKIFEEMVQKAER
EFGIKRRF
Download sequence
Identical sequences D2C5H7
gi|281411548|ref|YP_003345627.1| WP_012895825.1.51822 590168.Tnap_0105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]