SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|281411798|ref|YP_003345877.1| from Thermotoga naphthophila RKU-10

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|281411798|ref|YP_003345877.1|
Domain Number 1 Region: 4-211
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.51e-60
Family PP-loop ATPase 0.0000184
Further Details:      
 
Domain Number 2 Region: 341-404
Classification Level Classification E-value
Superfamily PheT/TilS domain 8.37e-16
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|281411798|ref|YP_003345877.1|
Sequence length 431
Comment tRNA(Ile)-lysidine synthetase [Thermotoga naphthophila RKU-10]
Sequence
MSDEFEERFLSFLKEEKLLEEGEHVLVAVSGGIDSMTLLYVLKKFSPLLKIKITAAHLDH
RIRESSRRDREFVERICRQWNVPVETSEVDVPSLWKDSGKTLEEIARELRYDFLRRTAKK
VGATKIALAHHKNDLLETVVHRLIRGTGPLGLACISPKREEFIRPFLVFKRSEIEEYARE
KGVPYVVDETNYDVKYTRNFIRHRIVPLMKELNPTVEDAVYRLVSVTLLLRNFVERTVQD
FVERNVYFYKDYAVFAEPEDPFFFLEVTRWVLKEMCGRVPEYEKLIGALKSKRVELWSGV
FVERSFGYVAVGKTVFREKYRVEVKGDMLEMEGFKIRVVNNRNDMKFWVRNRKEGDRIIV
NGRERKLKDVFIEKKVPTFYRDRVPLLVDEEDRVLWVPGIARSNFLPEDVVVELLEYPVG
YVKGGTYFEQI
Download sequence
Identical sequences D2C677
590168.Tnap_0361 gi|281411798|ref|YP_003345877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]